GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoB in Shewanella oneidensis MR-1

Align Phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate 200397 SO1219 phosphopentomutase (NCBI ptt file)

Query= reanno::MR1:200397
         (404 letters)



>lcl|FitnessBrowser__MR1:200397 SO1219 phosphopentomutase (NCBI ptt
           file)
          Length = 404

 Score =  823 bits (2125), Expect = 0.0
 Identities = 404/404 (100%), Positives = 404/404 (100%)

Query: 1   MKRTVIMMLDSFGVGAAGDAAKFGDVGSDTFGHIAKACAEGKADTGRKGPLALPNLARLG 60
           MKRTVIMMLDSFGVGAAGDAAKFGDVGSDTFGHIAKACAEGKADTGRKGPLALPNLARLG
Sbjct: 1   MKRTVIMMLDSFGVGAAGDAAKFGDVGSDTFGHIAKACAEGKADTGRKGPLALPNLARLG 60

Query: 61  LAHAAMESTGAFAPGFADNVDLIGAYGHAQELSSGKDTPSGHWEMAGVPVLFEWGYFSEH 120
           LAHAAMESTGAFAPGFADNVDLIGAYGHAQELSSGKDTPSGHWEMAGVPVLFEWGYFSEH
Sbjct: 61  LAHAAMESTGAFAPGFADNVDLIGAYGHAQELSSGKDTPSGHWEMAGVPVLFEWGYFSEH 120

Query: 121 QNSFPKELTDKILARAGLDGFLGNCHASGTTILEELGEEHMRSGKPIFYTSADSVFQIAC 180
           QNSFPKELTDKILARAGLDGFLGNCHASGTTILEELGEEHMRSGKPIFYTSADSVFQIAC
Sbjct: 121 QNSFPKELTDKILARAGLDGFLGNCHASGTTILEELGEEHMRSGKPIFYTSADSVFQIAC 180

Query: 181 HEGTFGLENLYRLCEIAREELEPYNIGRVIARPFDGTGPSDFARTGNRKDYSLEPPAKTV 240
           HEGTFGLENLYRLCEIAREELEPYNIGRVIARPFDGTGPSDFARTGNRKDYSLEPPAKTV
Sbjct: 181 HEGTFGLENLYRLCEIAREELEPYNIGRVIARPFDGTGPSDFARTGNRKDYSLEPPAKTV 240

Query: 241 LDKLKAAGGEVVSVGKIADIYAYCGITKKVKANGLEALFDATLAEVKSAGENTIVFTNFV 300
           LDKLKAAGGEVVSVGKIADIYAYCGITKKVKANGLEALFDATLAEVKSAGENTIVFTNFV
Sbjct: 241 LDKLKAAGGEVVSVGKIADIYAYCGITKKVKANGLEALFDATLAEVKSAGENTIVFTNFV 300

Query: 301 DFDSHYGHRRDVAGYAKGLEYFDARLPEMLALLDEDDLLILTADHGCDPTWQGTDHTREY 360
           DFDSHYGHRRDVAGYAKGLEYFDARLPEMLALLDEDDLLILTADHGCDPTWQGTDHTREY
Sbjct: 301 DFDSHYGHRRDVAGYAKGLEYFDARLPEMLALLDEDDLLILTADHGCDPTWQGTDHTREY 360

Query: 361 VPVLAYGAGLKAGSLGRRNSFADIGQSIASYFKLEPMEYGESFI 404
           VPVLAYGAGLKAGSLGRRNSFADIGQSIASYFKLEPMEYGESFI
Sbjct: 361 VPVLAYGAGLKAGSLGRRNSFADIGQSIASYFKLEPMEYGESFI 404


Lambda     K      H
   0.318    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 810
Number of extensions: 23
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 404
Length of database: 404
Length adjustment: 31
Effective length of query: 373
Effective length of database: 373
Effective search space:   139129
Effective search space used:   139129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate 200397 SO1219 (phosphopentomutase (NCBI ptt file))
to HMM TIGR01696 (deoB: phosphopentomutase (EC 5.4.2.7))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01696.hmm
# target sequence database:        /tmp/gapView.21663.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01696  [M=381]
Accession:   TIGR01696
Description: deoB: phosphopentomutase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
   1.2e-171  556.7   0.0   1.3e-171  556.5   0.0    1.0  1  lcl|FitnessBrowser__MR1:200397  SO1219 phosphopentomutase (NCBI 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__MR1:200397  SO1219 phosphopentomutase (NCBI ptt file)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  556.5   0.0  1.3e-171  1.3e-171       1     381 []       3     402 ..       3     402 .. 0.98

  Alignments for each domain:
  == domain 1  score: 556.5 bits;  conditional E-value: 1.3e-171
                       TIGR01696   1 rvflivldsvGiGeaedaadfkdeGadtlghiaealdk..........lnlpnleklGlgkiee......lagvdavee 63 
                                     r+ +++lds+G+G+a daa+f+d+G+dt+ghia+a+++          l lpnl++lGl+++         +g  ++ +
  lcl|FitnessBrowser__MR1:200397   3 RTVIMMLDSFGVGAAGDAAKFGDVGSDTFGHIAKACAEgkadtgrkgpLALPNLARLGLAHAAMestgafAPGFADNVD 81 
                                     6789*********************************99*********************9877689999999****** PP

                       TIGR01696  64 vlayyaklseassGkdtmtGhweiaGlnilkefkvfs...ngfpeelldkleeragrk.vlgnkpasGtvildelGeeh 138
                                      +++y++++e+ssGkdt++Ghwe+aG+++l+e+++fs   n+fp+el dk+  rag+  +lgn++asGt+il+elGeeh
  lcl|FitnessBrowser__MR1:200397  82 LIGAYGHAQELSSGKDTPSGHWEMAGVPVLFEWGYFSehqNSFPKELTDKILARAGLDgFLGNCHASGTTILEELGEEH 160
                                     *************************************9999*****************9******************** PP

                       TIGR01696 139 mktGklivytsadsvlqiaaheevvpleelyelcekarellkdpkyliGriiarpfvGe.aGnfkrtsnrhdyalkpfa 216
                                     m++Gk+i+ytsadsv+qia+he +++le+ly+lce+are+l    y+iGr+iarpf G  + +f rt+nr+dy+l+p+a
  lcl|FitnessBrowser__MR1:200397 161 MRSGKPIFYTSADSVFQIACHEGTFGLENLYRLCEIAREELE--PYNIGRVIARPFDGTgPSDFARTGNRKDYSLEPPA 237
                                     ****************************************96..5*************99******************* PP

                       TIGR01696 217 ktvldklkdekydvisiGkiadiydgeGitkkvrtksnmdgldkvikelkedftg.isfanlvdfdalyGhrrdkeGya 294
                                     ktvldklk ++ +v+s+Gkiadiy+ +Gitkkv+++++++++d+++ e+k ++++ i+f+n+vdfd+ yGhrrd++Gya
  lcl|FitnessBrowser__MR1:200397 238 KTVLDKLKAAGGEVVSVGKIADIYAYCGITKKVKANGLEALFDATLAEVKSAGENtIVFTNFVDFDSHYGHRRDVAGYA 316
                                     ******************************************************99*********************** PP

                       TIGR01696 295 aaleefdarlpellsklreddlliltadhGndptatGtdhtreyipvlvyspkvkkgqalesaetfadiGatladnfnt 373
                                     ++le fdarlpe+l++l eddlliltadhG+dpt++Gtdhtrey+pvl+y+   k g +l+++++fadiG+++a +f+ 
  lcl|FitnessBrowser__MR1:200397 317 KGLEYFDARLPEMLALLDEDDLLILTADHGCDPTWQGTDHTREYVPVLAYGAGLKAG-SLGRRNSFADIGQSIASYFKL 394
                                     *********************************************************.********************* PP

                       TIGR01696 374 skpeyGks 381
                                     + +eyG s
  lcl|FitnessBrowser__MR1:200397 395 EPMEYGES 402
                                     ******86 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (381 nodes)
Target sequences:                          1  (404 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 9.33
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory