GapMind for catabolism of small carbon sources

 

Aligments for a candidate for treEIIA in Shewanella oneidensis MR-1

Align D-trehalose PTS system, I, HPr, and IIA components (characterized)
to candidate 200507 SO1332 phosphoenolpyruvate-protein phosphotransferase PtsP (NCBI ptt file)

Query= reanno::WCS417:GFF4500
         (838 letters)



>lcl|FitnessBrowser__MR1:200507 SO1332 phosphoenolpyruvate-protein
           phosphotransferase PtsP (NCBI ptt file)
          Length = 744

 Score =  292 bits (748), Expect = 4e-83
 Identities = 201/630 (31%), Positives = 321/630 (50%), Gaps = 28/630 (4%)

Query: 211 KSLVAIMALQTVQGDTLQVSAAGEDAEAAIKALVALLAEGCGEAVVNVAEPVATQSSATL 270
           K++V ++ +Q  Q    Q S   E     + A +A+   G  +        V++     L
Sbjct: 117 KAVVGVIVVQ--QASARQFSEGEEAFLMTLAAQLAMAIRGLKQKA-----QVSSLHQQIL 169

Query: 271 LRGVCASPGSAF------GQVVQVTDPELVITEQGTGGATERAALTRGLLAANEALQVLQ 324
            +G  AS G A       G  + +  P++   +       E   L   +    EA+  L 
Sbjct: 170 FQGTSASSGIAIAHAFVLGGEISLEQPDIRCEDI----VLESNRLVAAMGRCKEAIGALS 225

Query: 325 ---DKAAGSAQAEIFRAHQELLEDPTLLEHAHRLLGEGKSAAFAWNSATLATVTLFQGLG 381
              D+      A IF A Q LL+D +L     R +  G  A  A +  +L  +  F  + 
Sbjct: 226 QRFDREQDEEVASIFNALQLLLDDASLGGEYAREVLLGWEAESAVSRVSLRYIQQFLAME 285

Query: 382 NALIAERAADLADVGQRVLKLILGIQDSAWDLPERAILIAEQLTPSQTASLDTRKVLGFV 441
           +  + ERA+D+ D+GQ+VL+ ++  +    +  +  IL+ ++   +  A    +K+ G V
Sbjct: 286 DPYLKERASDIRDLGQKVLRQLIEPERLELEPDKPVILVTKEADATMLAEFPRQKLAGIV 345

Query: 442 TVAGGATSHVAILARALGLPAICGVPAQVLALANGKQVLLDADKGELHLEPNLAEIEQLE 501
           T  GG  SH AILARALG+PAI GV   + A  + K ++++A +G+L + P+ A + +  
Sbjct: 346 TELGGVNSHAAILARALGVPAITGVEQLLSADIDQKLLVVNASRGQLMVSPSPAIVSEYR 405

Query: 502 AARKHQVLRHQRDVAQASLPATTRDGHHVEVTANVASLQEVEHALTLGGEGVGLLRSEFL 561
           +    Q    ++   + +LP+   DG  + +  N   L  V   +  G +G+GL R+E  
Sbjct: 406 SLISAQKALQRQYAQELTLPSVMLDGKRIRLYLNAGLLSGVASEIAEGADGIGLYRTEIP 465

Query: 562 YLDRNRAPSPEEQAGTYTAIARALGTERNLVVRTLDVGGDKPLAYVPMDAETNPFLGLRG 621
           ++ + R PS  EQ   Y  +  A  + R +V+RTLDVGGDKPL Y P+  E NPFLG RG
Sbjct: 466 FMLQQRFPSESEQVKVYQQVLSA-ASGRPVVMRTLDVGGDKPLPYFPI-KEDNPFLGWRG 523

Query: 622 IRLCLERPQLLREQFRAIL-ASAGFARLHIMLPMVSLLSELHLARKILEEEALAL----- 675
           IRL L+ P+L   Q RA+L A A   +L I+LPMVS L E+  A   LE+  + L     
Sbjct: 524 IRLSLDHPELFLVQLRAMLQAGAEGKQLSILLPMVSNLDEIDQALAYLEQAHVELKNDVN 583

Query: 676 GLTELPKLGIMIEVPSAALMADVFAPHVDFFSIGTNDLTQYTLAMDRDHPRLANQADSFH 735
              ++P++GIM+EVP+     D  A  VDF S+G+NDLTQY LA+DR++PR+++  DS+H
Sbjct: 584 SNIKMPRIGIMLEVPAMLYQLDEVAKRVDFVSVGSNDLTQYLLAVDRNNPRVSSLFDSYH 643

Query: 736 PAVLRLIATTVKAAHAHGKWVGVCGALASEALAVPVLIGLGVDELSVSVPLIPTIKATVR 795
           P +LR +         H   + +CG LA E +   +L+ +G  +LS++   +  I   +R
Sbjct: 644 PGILRALHQARLDCEYHHLDISICGELAGEPMGAILLVAMGYHQLSMNQGSLARINYLLR 703

Query: 796 ELDLADCQIIARQVLGLEEAAEVREALRQY 825
            +   D   +  Q L L    +VRE +++Y
Sbjct: 704 RVSGEDLAQLLAQALSLSNGFQVRELVKEY 733


Lambda     K      H
   0.318    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1118
Number of extensions: 44
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 838
Length of database: 744
Length adjustment: 41
Effective length of query: 797
Effective length of database: 703
Effective search space:   560291
Effective search space used:   560291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory