Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate 200225 SO1042 amino acid ABC transporter, ATP-binding protein (NCBI ptt file)
Query= uniprot:P70970 (276 letters) >FitnessBrowser__MR1:200225 Length = 241 Score = 142 bits (358), Expect = 7e-39 Identities = 89/223 (39%), Positives = 138/223 (61%), Gaps = 8/223 (3%) Query: 6 ERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNK 65 + L IN I++G V+VIG +GSGKST L+ +N L PT+G I + I A K+ Sbjct: 13 DNAVLKGINEHIRQGEVVSVIGPSGSGKSTFLRCINLLENPTQGDIEIEGQSITA--KDA 70 Query: 66 DLKKLRKKVGIVFQFPEHQLF-EETVLKDISFGPMNFGVKKE-DAEQKAREMLQLVGLSE 123 + KLR+KVG+VFQ LF +TVL++I+ P++ + + +A+ KA +L VGL + Sbjct: 71 CVDKLRQKVGMVFQ--NFNLFPHKTVLQNITLAPVSLKLMTQAEADNKALALLTQVGLQD 128 Query: 124 ELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGN 183 + + P LSGGQ +RVAIA LAM+P++++ DEPT+ LDP +++D+ +L Q+G Sbjct: 129 KA-NAYPSSLSGGQKQRVAIARALAMEPDLMLFDEPTSALDPEMVGDVLDVMKDLAQKG- 186 Query: 184 LTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFLKGEE 226 +T ++VTH M A +D +I M G + S P +LF + +E Sbjct: 187 MTMVIVTHEMGFARDVSDRVIFMDGGYVVESNIPEELFTRPKE 229 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 241 Length adjustment: 24 Effective length of query: 252 Effective length of database: 217 Effective search space: 54684 Effective search space used: 54684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory