GapMind for catabolism of small carbon sources

 

Alignments for a candidate for nbaF in Shewanella oneidensis MR-1

Align 2-aminomuconate deaminase (EC 3.5.99.5) (characterized)
to candidate 200579 SO1404 endoribonuclease L-PSP, putative (NCBI ptt file)

Query= metacyc::MONOMER-13362
         (143 letters)



>FitnessBrowser__MR1:200579
          Length = 128

 Score = 63.9 bits (154), Expect = 8e-16
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 10/120 (8%)

Query: 16  GKFPHIKRAGDFLFVSGTSSRRPDNTLVGVEVDAMGTTRLDIVAQTTAVIENIRDILGSV 75
           G + H  R G+ +F SG          + V  D  G     I  Q+   +EN++ +L + 
Sbjct: 16  GPYSHGTRYGNLIFTSGQ---------LPVCKDKGGVVDGGISEQSVQCLENLKYVLEAG 66

Query: 76  GATLDDVVEISTFLVNMNDFAGYNEVYGTYFGYEGPTRTTVAVHQLPHPHLLIEIKAVAY 135
           G +LD V++ + +L  ++DFA +NEVY TYF  + P R+  AV  LP   + +EI+A+A+
Sbjct: 67  GGSLDTVLKTTCYLSEISDFAAFNEVYKTYFKTDCPARSCFAVKDLP-LGVKVEIEAIAH 125


Lambda     K      H
   0.318    0.136    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 45
Number of extensions: 4
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 143
Length of database: 128
Length adjustment: 15
Effective length of query: 128
Effective length of database: 113
Effective search space:    14464
Effective search space used:    14464
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 42 (20.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory