Align isobutyryl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate 201633 SO2492 oxidoreductase, acyl-CoA dehydrogenase family (NCBI ptt file)
Query= reanno::pseudo3_N2E3:AO353_25670 (383 letters) >FitnessBrowser__MR1:201633 Length = 759 Score = 100 bits (250), Expect = 1e-25 Identities = 91/316 (28%), Positives = 150/316 (47%), Gaps = 26/316 (8%) Query: 50 GLLGMVVPEEWGGTYVDYVAYALAVEEISAGDGATGALMSIHNSVGCGPVL-NYGTEEQK 108 G +++P+++GG A + V ++++ + + + NS+G G +L +YGTEEQK Sbjct: 121 GFFALIIPKKFGGKAFSAYANSTIVSKLASRSVSAAVTVMVPNSLGPGELLTHYGTEEQK 180 Query: 109 QTWLADLASGQAIGCFCLTEPQAGSEAHNLRTRAELRDGQW--------VINGAKQFVSN 160 + WL LA G I CF LT P+AGS+A + + G++ + K++++ Sbjct: 181 ERWLPALAKGDEIPCFALTGPEAGSDAGAIPDVGIVCRGEFNGEEVLGLKLTWNKRYITL 240 Query: 161 GRRAK-LAIVFAVTDPD--LGKK---GLSAFLVPTDTPGFIVDRSEHKMGIRASDTCAVT 214 A L + F + DPD LG+K G++ L+PTD PG ++ R + + + A Sbjct: 241 APVATVLGLAFQMRDPDGLLGEKKNLGITCALIPTDHPGVVIGRRHNPLNM-AFMNGTTQ 299 Query: 215 LNNCTIPEANLLGE---RGKGLAIALSNLEGGR-IGIAAQALGIARAAFEAALAYARDRV 270 + IP ++G G+G + + L GR I + A A A + AY+ R Sbjct: 300 GDEVFIPLDWIIGGPEFAGRGWRMLVECLSAGRGISLPALATASGHMATKTTTAYSYVRH 359 Query: 271 QFDKPIIEHQSVANMLADMHT---RLNAARLLILHAARLRSAGKPCLSEASQAKLFASEM 327 QF I + + V LA + +L AAR L L+ KP + A AK +E+ Sbjct: 360 QFGMAIGQFEGVQEALARIIANTYQLEAARRLTTTGIDLKV--KPSVVTAI-AKFHMTEL 416 Query: 328 AEKVCSSAIQIHGGYG 343 V + A+ I G G Sbjct: 417 GRAVMNDAMDIQSGKG 432 Lambda K H 0.319 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 759 Length adjustment: 35 Effective length of query: 348 Effective length of database: 724 Effective search space: 251952 Effective search space used: 251952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory