Align 3-hydroxy-isobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate 200846 SO1681 enoyl-CoA hydratase/isomerase family protein (NCBI ptt file)
Query= reanno::pseudo3_N2E3:AO353_25665 (368 letters) >FitnessBrowser__MR1:200846 Length = 383 Score = 248 bits (634), Expect = 1e-70 Identities = 146/334 (43%), Positives = 204/334 (61%), Gaps = 13/334 (3%) Query: 28 IGHLTLNRPAGLNAITLDMVRSLHRQLDAWSKDPHIHAVVLRGAGEKAFCAGGDIRSLYD 87 +G +TLN LNA+ LDMVR++ QL+ W KDP I VVL G+GEKAFCAGGD+R+LY Sbjct: 30 VGVVTLNVEKALNALDLDMVRAMTVQLNLWKKDPLIACVVLDGSGEKAFCAGGDVRALYH 89 Query: 88 -SFKSGGTLHED---FFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLVQGADLRVVTE 143 S + G + E FF EEY LD +H Y KPVL DG V+GGG+GL+ GA +VVTE Sbjct: 90 ASVAAKGQVTEVAKVFFEEEYRLDYLLHTYGKPVLVWGDGIVMGGGLGLMAGASHKVVTE 149 Query: 144 RSRLAMPEVAIGYFPDVGGSYFLPRIPGELGIYLGVSGVQIRAADALYCGLADWYLESQK 203 SR+AMPEV IG +PDVGGSYFL R+PG++G++LG++ + AADA Y GLAD YL Sbjct: 150 TSRIAMPEVTIGLYPDVGGSYFLNRMPGKMGLFLGLTAYHMNAADACYVGLADHYLNRDD 209 Query: 204 LAELDQHLDSLEWHDTPL---KDLQGLLAKLALQ-QLP--DAPLQALRPTIDHFFALPDV 257 + + +L+W D+P + L ++ +L+ Q +P D+ L + ID A + Sbjct: 210 KELMFDAMATLDWSDSPALNHQRLDTMINELSNQVDIPKGDSVLAESQEMIDRLMA-GSL 268 Query: 258 PSIVEQLRTVTVADSHDWAMTTADLLDSRSPLAMGVTLEMLRRGRQLSLENCFALELHLD 317 IV ++ T++ ++ W + + SP++ + + G +LSL CF EL + Sbjct: 269 TDIVTRMSTLSTDEA--WLSKACATMLAGSPISWHLAYIQTQLGTKLSLAQCFKWELTVS 326 Query: 318 RQWFERGDLIEGVRALLIDKDKSPRWNPPTVQAL 351 +GD EGVRALLIDKDK P+W VQ++ Sbjct: 327 VNVCAKGDFCEGVRALLIDKDKQPKWQFADVQSV 360 Lambda K H 0.321 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 383 Length adjustment: 30 Effective length of query: 338 Effective length of database: 353 Effective search space: 119314 Effective search space used: 119314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory