Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate 201485 SO2341 alpha keto acid dehydrogenase complex, E2 component (NCBI ptt file)
Query= reanno::Marino:GFF1672 (378 letters) >FitnessBrowser__MR1:201485 Length = 535 Score = 378 bits (971), Expect = e-109 Identities = 209/388 (53%), Positives = 264/388 (68%), Gaps = 11/388 (2%) Query: 1 MTDKAMVEITAPKAGRVTKLYHQQQAMAKVHAPLFAFIPRDREEPEEARTKPEPAAQLST 60 MTDKA+V+I A KAG++ KL++++ +AKVHAPL+A P + + A +T Sbjct: 147 MTDKALVQIPAIKAGKIVKLHYRKGQLAKVHAPLYAIEVEGGVIPAVSAHETTNVAVANT 206 Query: 61 ATASPVAAASRQRIPA-------SPAVRRLVREHELNLSDIQGSGKDGRVLKADVLAYIE 113 AT++ A AS + PA SPAVRR+ R +++LS + GSGK GRV K D+ + Sbjct: 207 ATSAACATASVSQEPARQGKALASPAVRRMARALDIDLSRVPGSGKHGRVYKEDISRFQA 266 Query: 114 EGPKQ--AQNQAPADDAQTATTRSARRAPAADQEAR--VEPIRGIKAAMAKSMVKSATTI 169 +G A A Q++ T+SA A VEPIRG+KA MAK MV+S +TI Sbjct: 267 QGSATPVVAPVATASTQQSSVTQSAVPITVASAARADIVEPIRGVKAVMAKLMVESVSTI 326 Query: 170 PHFIYSEDIDVTDLLKLREQLKPEAEARGSRLTLMPFFMKAMALAVQEFPVLNSQLNDDV 229 PHF Y E+ D+TDL+ LRE +K + + +LT+MPFFMKAM+LA+ +FPVLNSQ+N D Sbjct: 327 PHFTYCEEFDLTDLVALRESMKAKYSSDEVKLTMMPFFMKAMSLALTQFPVLNSQVNADC 386 Query: 230 TEIHYLPQCNIGMAVDGKAGLTVPNIKGVESLSLLGIADEVARLTEAARSGRVSQEDLKG 289 TEI Y + NIGMAVD K GL VPN+K V+ S+L +A E+ RLT AARSGRV+ DLK Sbjct: 387 TEITYKARHNIGMAVDSKVGLLVPNVKDVQDKSILEVAAEITRLTNAARSGRVAPADLKE 446 Query: 290 GTITISNIGALGGTYTAPIINAPEVAIVALGRTQKLPRFDANGQVVERAIMTVSWAGDHR 349 GTI+ISNIGALGGT PIIN PEVAIVALG+ Q LPRF+A G+V R IM VSW+GDHR Sbjct: 447 GTISISNIGALGGTVATPIINKPEVAIVALGKLQTLPRFNAKGEVEARQIMQVSWSGDHR 506 Query: 350 IIDGGTIARFCNRWKGYLESPQTMLLHM 377 +IDGGTIARFCN WK YLE PQ MLL M Sbjct: 507 VIDGGTIARFCNLWKQYLEQPQDMLLAM 534 Score = 53.5 bits (127), Expect = 1e-11 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 2/70 (2%) Query: 1 MTDKAMVEITAPKAGRVTKLYHQQQAMAKVHAPLFAFIPRDREEPEEARTKPEPAAQLST 60 MTDKA+V+I AP AG VTKLY+ + +AKVHAPL+A + + EEP ++ P+ + Sbjct: 40 MTDKALVQIPAPFAGVVTKLYYAKGDIAKVHAPLYA-VQIEAEEP-SSQVAPQTVEHSAP 97 Query: 61 ATASPVAAAS 70 A+ AA+S Sbjct: 98 NQAAISAASS 107 Lambda K H 0.316 0.131 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 378 Length of database: 535 Length adjustment: 33 Effective length of query: 345 Effective length of database: 502 Effective search space: 173190 Effective search space used: 173190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory