Align 3-hydroxyisobutyrate dehydrogenase subunit (EC 1.1.1.31) (characterized)
to candidate 201906 SO2771 2-hydroxy-3-oxopropionate reductase (NCBI ptt file)
Query= metacyc::MONOMER-11664 (295 letters) >FitnessBrowser__MR1:201906 Length = 291 Score = 174 bits (440), Expect = 3e-48 Identities = 102/297 (34%), Positives = 155/297 (52%), Gaps = 16/297 (5%) Query: 2 RIAFIGLGNMGAPMARNLIKAGHQLNLFDLNKTVLAE---LAELGGQISPSPKDAAANSE 58 ++AFIGLG MG PMAR+L+ GH++ ++ N+T + GG+ P+PK+AA + Sbjct: 3 KVAFIGLGVMGYPMARHLLNKGHEVTVY--NRTFAKAQTWVDTYGGRCCPTPKEAAIGQD 60 Query: 59 LVITMLPAAAHVRSVYLNDDGVLAGIRPGTPTVDCSTIDPQTARDVSKAAAAKGVDMGDA 118 +V T + +R V L DDGV+ G+ GT VD +T AR++ K KG+D DA Sbjct: 61 IVFTCVGNDNDLREVVLGDDGVIHGMALGTVLVDHTTASADVARELHKVLGEKGIDFLDA 120 Query: 119 PVSGGTGGAAAGTLTFMVGASAELFASLKPVLEQMGRNIVHCGEVGTGQIAKICNNLLLG 178 PVSGG GA G LT MVG +F +KPV+E R GEVG GQ+ K+ N + + Sbjct: 121 PVSGGQAGAENGVLTVMVGGEQAVFERVKPVIEAFARCAERLGEVGAGQLTKMVNQICIA 180 Query: 179 ISMIGVSEAMALGNALGIDTKVLAGIINSSTGRCWSSDT--YNPWPGIIETAPASRGYTG 236 + G++EA+ G+D + + +I+ + W + W ++ Y Sbjct: 181 GVVQGLAEALQFARKAGLDGEKVVEVISKGAAQSWQMENRYKTMW---------AQNYDF 231 Query: 237 GFGAELMLKDLGLATEAARQAHQPVILGAVAQQLYQAMSLRGEGGKDFSAIVEGYRK 293 GF + M KDLG+A E AR+ + L A+ Q Y + G D S+++ + K Sbjct: 232 GFAVDWMRKDLGIALEEARRNGSHLPLTALVDQFYSEVQAMGGNRWDTSSLLARFEK 288 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 291 Length adjustment: 26 Effective length of query: 269 Effective length of database: 265 Effective search space: 71285 Effective search space used: 71285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory