Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate 203725 SO4655 sulfate ABC transporter, ATP-binding protein (NCBI ptt file)
Query= reanno::WCS417:GFF4321 (386 letters) >FitnessBrowser__MR1:203725 Length = 354 Score = 204 bits (518), Expect = 4e-57 Identities = 102/240 (42%), Positives = 155/240 (64%), Gaps = 6/240 (2%) Query: 3 TLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGGAI 62 ++ ++ VNK +G + + ++ L IK GE L+GPSG GK+TL+ IAGLE G + Sbjct: 2 SIHIQQVNKHFGNFV--AVDSVNLEIKTGELTALLGPSGSGKTTLLRIIAGLEQADSGIV 59 Query: 63 MIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIR----KMPQADIDAEVAR 118 +D++ +R + VFQ YAL+ M+V EN+ +GL +R + +A+I +V Sbjct: 60 KFNGEDITTQHVSERGVGFVFQHYALFKHMTVFENVAYGLTVRPRKTRPSKAEIAEKVHS 119 Query: 119 VAKLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEM 178 + KL+Q++ +R P QLSGGQ+QR+A+ RALA PK+ L DEP LDAK+R E+R + Sbjct: 120 LLKLVQLDWTADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRAELRRWL 179 Query: 179 KLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGS 238 + +H + TTV+VTHDQ EA+ + DK+ VM G I+Q GTP+E+Y+ P+N FV F+G+ Sbjct: 180 RRLHDEINVTTVFVTHDQEEALEVADKIVVMNKGRIEQQGTPEEVYDTPSNPFVYEFLGN 239 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 354 Length adjustment: 30 Effective length of query: 356 Effective length of database: 324 Effective search space: 115344 Effective search space used: 115344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory