Protein GFF3356 in Marinobacter adhaerens HP15
Annotation: FitnessBrowser__Marino:GFF3356
Length: 352 amino acids
Source: Marino in FitnessBrowser
Candidate for 5 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-histidine catabolism | hutV | med | ABC transporter for L-Histidine, ATPase component (characterized) | 55% | 97% | 294.3 | OtaA, component of The salt-induced glycine betaine OtaABC transporter | 54% | 305.8 |
| L-proline catabolism | hutV | med | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 55% | 95% | 293.9 | OtaA, component of The salt-induced glycine betaine OtaABC transporter | 54% | 305.8 |
| L-proline catabolism | proV | med | glycine betaine/l-proline transport atp-binding protein prov (characterized) | 45% | 83% | 291.2 | OtaA, component of The salt-induced glycine betaine OtaABC transporter | 54% | 305.8 |
| L-proline catabolism | opuBA | lo | BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) | 50% | 69% | 280.8 | OtaA, component of The salt-induced glycine betaine OtaABC transporter | 54% | 305.8 |
| L-histidine catabolism | PA5503 | lo | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) | 42% | 70% | 179.9 | OtaA, component of The salt-induced glycine betaine OtaABC transporter | 54% | 305.8 |
Sequence Analysis Tools
View GFF3356 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MAKDIKISIRNLYKIFGPTPDVALEYVRKGMGKADLLEQQRHVLGLRDINVDIHDGEITV
IMGLSGSGKSTLIRHLNRLIDPTAGEIRVDGEDIMSYSEEQLRKLRRERMSMVFQKFALL
PHKTVLENAGMAKDIRGYTTSDFEADARKWLARVGLEGNEYQYPHQLSGGMQQRVGIARA
LVSDAPIMLMDEAFSALDPLIRSDMQDLLLELQEELQKTIVFITHDLDEALKLADHLVIL
KDGEVVQQGDPQEILLNPGDPYIVDFISDINRARVLRVRSVMSPPDDGEATFAGDISEKD
NLETVLLKSDGDMSLNFRVVRDDQHVGTLHMKDLARALVPTAASADRNKTAA
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory