Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate GFF1091 HP15_1069 TRAP transporter solute receptor, TAXI family protein
Query= reanno::psRCH2:GFF85 (317 letters) >FitnessBrowser__Marino:GFF1091 Length = 327 Score = 165 bits (417), Expect = 2e-45 Identities = 106/315 (33%), Positives = 159/315 (50%), Gaps = 8/315 (2%) Query: 10 LAAAAAFTASTAAVAAPT--FINILTGGTSGVYYPIGVALSQQYN---KIDGAKTSVQAT 64 +AAA + A++ +V+A F+ I TGG +GVYYP G A+ + N K G + SV++T Sbjct: 12 VAAAVSLGAASTSVSAQEQRFVTIGTGGVTGVYYPAGGAICRLVNMDRKEHGIRCSVEST 71 Query: 65 KASVENLNLLQAGRGELAFSLGDSVEDAWNGVEDAGFKAPLKRLRAIAGTYNNYIQIVAS 124 SV NLN ++ G +LA + D A+NG K LRA+ + +VAS Sbjct: 72 GGSVYNLNAIRQGELDLAVAQSDWQYHAYNGTSQFKDDGANKDLRAVFSLHPEPFTVVAS 131 Query: 125 AESGIKTLDDLKGKRISVGAPKSGTELNARAIFKAAGLDYKDMGRVEFLPYAESVELIKN 184 SGIKT +DL+GKR+SVG P SG A + G + AE + + + Sbjct: 132 KGSGIKTFEDLEGKRVSVGNPGSGQRATAEVLMDEMGWTLDKFSLAAEIKAAEQSQALCD 191 Query: 185 RQLDATLQSSGLGMAAIRDLASTMPVTFVEIPAEVVEKI--ESDAYLAGVIPAGTYDGQD 242 +DA + G AI++ ++ V + +K+ E+ Y VIP G Y G D Sbjct: 192 GNIDAFFYTVGHPSGAIKEATTSCDSVLVNVDNAATQKLIDENPYYRKAVIPGGMYRGSD 251 Query: 243 ADVPTVAITNILVTHEKVSDEVAYQMTKLMFDNLAALGNAHSAAKDI-KLENATKNLPIP 301 DV T + V+ V D+V Y + K +F+N + H A ++ K E + L P Sbjct: 252 DDVTTFGVAATFVSSTDVPDDVVYAVVKAVFENFDSFKRLHPAFANLNKEEMVSDALSAP 311 Query: 302 LHPGAERFYKEAGVL 316 LHPGA ++YKEAG++ Sbjct: 312 LHPGAAKYYKEAGLI 326 Lambda K H 0.314 0.131 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 327 Length adjustment: 28 Effective length of query: 289 Effective length of database: 299 Effective search space: 86411 Effective search space used: 86411 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory