Align Alpha-ketoglutarate permease (characterized)
to candidate GFF1381 HP15_1348 major facilitator family transporter
Query= SwissProt::P0AEX3 (432 letters) >FitnessBrowser__Marino:GFF1381 Length = 414 Score = 227 bits (578), Expect = 6e-64 Identities = 130/400 (32%), Positives = 213/400 (53%), Gaps = 6/400 (1%) Query: 30 GNLVEWFDFYVYSFCSLYFAHIFFPSGNTTTQLLQTAGVFAAGFLMRPIGGWLFGRIADK 89 GN+VEW+DF VY + + A +FF S N T L+ T G+FAAGF+MRP+G +FG D+ Sbjct: 6 GNVVEWYDFAVYGYLAGVIAPVFFSSANPTAALIGTYGIFAAGFIMRPLGAAVFGWFGDR 65 Query: 90 HGRKKSMLLSVCMMCFGSLVIACLPGYETIGTWAPALLLLARLFQGLSVGGEYGTSATYM 149 +GR ++M +SV +M +L++ LP Y+ G AP LL+L RL QGLSVGGE+ +SATY+ Sbjct: 66 YGRARTMQISVMLMALPTLLLGMLPSYQQAGLLAPVLLVLIRLLQGLSVGGEFSSSATYL 125 Query: 150 SEVAVEGRKGFYASFQYVTLIGGQLLALLVVVVLQHTMEDAALREWGWRIPFALGAVLAV 209 E A +G++G S+ + + G LL + ++ +T+++ L +WGWR+PF GA+L + Sbjct: 126 VETAPDGKRGLTGSWANIGSMTGSLLGVAAAALVTNTLDEQTLSDWGWRLPFLGGAILGI 185 Query: 210 VALWLRRQL---DETSQQETRALKEAGSLKGLWRNRRAFIMVLGFTAAGSLCFYTFTTYM 266 A+ +RR L + SQ + + L+ NRR ++ L F ++ C+Y Y+ Sbjct: 186 AAIAIRRNLHNSERFSQHHENRDETSPLLQAFTTNRRETLLALAFASSYGTCYYIVFVYL 245 Query: 267 QKYLVNTAGMHANVASGIMTAALFVFMLIQPLIGALSDKIGRRTSMLCFG-SLAAIFTVP 325 ++L + A I T + + + PL + D+ RR S + L + P Sbjct: 246 PEWLSAQELLSRGTALLINTGMMLLVIPAMPLFAIVGDRWLRRRSWIAISLFLLTVVAWP 305 Query: 326 ILS-ALQNVSSPYAAFGLVMCALLIVSFYTSISGILKAEMFPAQVRALGVGLSYAVANAI 384 + + L + S Y L+++ + L EMFP R G +++ + + Sbjct: 306 LHAWMLSSGGSLYVVVLAHALVFLLLAIPLGSAPALFVEMFPESDRLSGYSVAFNLGLGV 365 Query: 385 FGGSAEYVALSL-KSIGMETAFFWYVTLMAVVAFLVSLML 423 FGG +A SL + G+ TA Y+ + A +A L + + Sbjct: 366 FGGLTPMIATSLIATTGVVTAPAMYLAVTAFIAVLALIAM 405 Lambda K H 0.328 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 414 Length adjustment: 32 Effective length of query: 400 Effective length of database: 382 Effective search space: 152800 Effective search space used: 152800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory