GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mhpE in Marinobacter adhaerens HP15

Align 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39) (characterized)
to candidate GFF4096 HP15_4036 4-hydroxy-2-ketovalerate aldolase

Query= metacyc::MONOMER-3404
         (345 letters)



>lcl|FitnessBrowser__Marino:GFF4096 HP15_4036
           4-hydroxy-2-ketovalerate aldolase
          Length = 345

 Score =  591 bits (1524), Expect = e-174
 Identities = 291/345 (84%), Positives = 317/345 (91%)

Query: 1   MTFNPGKKLYISDVTLRDGSHAIRHQYSIQNVQDIARALDKARVDSIEVTHGDGLQGSSF 60
           MTFNPGKKLYISDVTLRDGSHAIRHQYSI+NVQDIARALDKA+VDSIEV HGDGLQGSSF
Sbjct: 1   MTFNPGKKLYISDVTLRDGSHAIRHQYSIKNVQDIARALDKAKVDSIEVAHGDGLQGSSF 60

Query: 61  NYGFGAHSDLEWIEAAADVIQHARVTVLLVPGIGTVHDLKAAYDAGARSVRVATHCTEAD 120
           NYGFGAH+DLEWIEA A+VI+HA++  LL+PGIGTVHDL  AY+AGAR VRVATHCTEAD
Sbjct: 61  NYGFGAHTDLEWIEAVAEVIEHAKIATLLLPGIGTVHDLDNAYNAGARIVRVATHCTEAD 120

Query: 121 VSRQHIEYARELGMDTVGFLMMSHMIPAEQLAAQGKLMETYGAQCIYMADSGGAMNMNDI 180
           VS+QHIE+AR+LGMDTVGFLMMSHM   + LA Q KLME YGA C+Y+ DSGGAMNMNDI
Sbjct: 121 VSKQHIEHARKLGMDTVGFLMMSHMQTPKGLAEQAKLMEDYGATCLYVVDSGGAMNMNDI 180

Query: 181 RDRMRAFKAVLNPQTQTGMHAHHNLSLGVANSIIAVEEGCDRIDASLAGMGAGAGNAPLE 240
           RDR RA K VL P+TQTGMHAHHNL+LGVANSI+AVEEGCDRIDASLAGMGAGAGNAPLE
Sbjct: 181 RDRFRALKDVLKPETQTGMHAHHNLALGVANSIVAVEEGCDRIDASLAGMGAGAGNAPLE 240

Query: 241 VFIAAAERLGWNHGTDLYTLMDAADDIVRPLQDRPVRVDRETLGLGYAGVYSSFLRHAEV 300
           V IAA +++GW HGTD+Y LMDAADDIVRPLQDRPVRVDRETL LGYAGVYSSFLRH+EV
Sbjct: 241 VCIAAFDKMGWEHGTDVYALMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEV 300

Query: 301 AAAKYGLKTLDILVELGRRRMVGGQEDMIVDVALDLLAARKEQQA 345
           AA KYGLK +DILVELG+RRMVGGQEDMIVDVALDLLAA+KEQ A
Sbjct: 301 AAQKYGLKAVDILVELGKRRMVGGQEDMIVDVALDLLAAQKEQNA 345


Lambda     K      H
   0.320    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 511
Number of extensions: 21
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 345
Length of database: 345
Length adjustment: 29
Effective length of query: 316
Effective length of database: 316
Effective search space:    99856
Effective search space used:    99856
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate GFF4096 HP15_4036 (4-hydroxy-2-ketovalerate aldolase)
to HMM TIGR03217 (dmpG: 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03217.hmm
# target sequence database:        /tmp/gapView.13590.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03217  [M=334]
Accession:   TIGR03217
Description: 4OH_2_O_val_ald: 4-hydroxy-2-oxovalerate aldolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   2.7e-182  591.3   9.8   3.2e-182  591.1   9.8    1.0  1  lcl|FitnessBrowser__Marino:GFF4096  HP15_4036 4-hydroxy-2-ketovalera


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Marino:GFF4096  HP15_4036 4-hydroxy-2-ketovalerate aldolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  591.1   9.8  3.2e-182  3.2e-182       1     333 [.       7     339 ..       7     340 .. 0.99

  Alignments for each domain:
  == domain 1  score: 591.1 bits;  conditional E-value: 3.2e-182
                           TIGR03217   1 kkltitdvtLrdGshavrhqftaeevraiaaaLdeagvdaievahGdGLggsslnyGfsaasdlelieaaaeavk 75 
                                         kkl+i+dvtLrdGsha+rhq+++++v++ia+aLd+a+vd+ievahGdGL+gss+nyGf+a++dle+iea+ae+++
  lcl|FitnessBrowser__Marino:GFF4096   7 KKLYISDVTLRDGSHAIRHQYSIKNVQDIARALDKAKVDSIEVAHGDGLQGSSFNYGFGAHTDLEWIEAVAEVIE 81 
                                         689************************************************************************ PP

                           TIGR03217  76 kakvavlllPGigtveelkaaadaGvkvvrvathcteadvseqhielarelgletvgfLmmshmaspeklaeqak 150
                                         +ak+a+lllPGigtv++l++a++aG+++vrvathcteadvs+qhie+ar+lg++tvgfLmmshm++p+ laeqak
  lcl|FitnessBrowser__Marino:GFF4096  82 HAKIATLLLPGIGTVHDLDNAYNAGARIVRVATHCTEADVSKQHIEHARKLGMDTVGFLMMSHMQTPKGLAEQAK 156
                                         *************************************************************************** PP

                           TIGR03217 151 llesyGadvvyvvdsaGallpedvkdrvkalkealkpetevGlhahenlslavansivaveeGatridaslaglG 225
                                         l+e+yGa+++yvvds+Ga++++d++dr++alk++lkpet++G+hah+nl+l+vansivaveeG++ridaslag+G
  lcl|FitnessBrowser__Marino:GFF4096 157 LMEDYGATCLYVVDSGGAMNMNDIRDRFRALKDVLKPETQTGMHAHHNLALGVANSIVAVEEGCDRIDASLAGMG 231
                                         *************************************************************************** PP

                           TIGR03217 226 agaGnaplevlvavldrlGletgvdlfklldaaedvvrPlldrpvrvdrealtlGyaGvyssflrhaeraaekyg 300
                                         agaGnaplev +a++d++G+e+g+d+++l+daa+d+vrPl+drpvrvdre+l+lGyaGvyssflrh+e aa+kyg
  lcl|FitnessBrowser__Marino:GFF4096 232 AGAGNAPLEVCIAAFDKMGWEHGTDVYALMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEVAAQKYG 306
                                         *************************************************************************** PP

                           TIGR03217 301 vdardilvelGrrklvgGqedmivdvaldlake 333
                                         ++a+dilvelG+r++vgGqedmivdvaldl+++
  lcl|FitnessBrowser__Marino:GFF4096 307 LKAVDILVELGKRRMVGGQEDMIVDVALDLLAA 339
                                         ******************************876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (334 nodes)
Target sequences:                          1  (345 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 10.01
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory