Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate GFF4003 HP15_3943 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-20679 (395 letters) >FitnessBrowser__Marino:GFF4003 Length = 365 Score = 470 bits (1209), Expect = e-137 Identities = 236/364 (64%), Positives = 288/364 (79%) Query: 30 LLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQGATGGNIARKALLRAGLPVTTAGTTIDRQ 89 + GH I+HAV+RAGIDP VEDV+MGAA Q+GA G NIAR A +RAGLPVTTAG +I+R Sbjct: 1 MAGHVIKHAVERAGIDPSIVEDVIMGAAYQEGAQGRNIARLAAIRAGLPVTTAGFSINRF 60 Query: 90 CASGLQAIALAARSVLFDGVEIAVGGGGESISLVQNDKMNTFHAVDPALEAIKGDVYMAM 149 C+SGLQ+IALAA+ V+ + V V GG ESISLVQN+K+N+FHA + L K ++Y++M Sbjct: 61 CSSGLQSIALAAQRVVSEKVPAMVAGGVESISLVQNEKINSFHATNEWLMKNKPELYLSM 120 Query: 150 LDTAETVAKRYGISRERQDEYSLESQRRTAAAQQGGKFNDEIAPISTKMGVVDKATGAVS 209 ++TA+ VAKRY +SRE QDEYSL SQ+RTAAAQQ GKF+DEI P M V DK TG VS Sbjct: 121 IETADIVAKRYNVSREAQDEYSLISQQRTAAAQQAGKFDDEIVPFDATMLVKDKETGEVS 180 Query: 210 FKDITLSQDEGPRPETTAEGLAGLKAVRGEGFTITAGNASQLSDGASATVIMSDKTAAAK 269 K +TL DE RP TT EGLAGL+ VRG ITAGNASQLSDGAS +M+ A Sbjct: 181 EKQVTLKGDECNRPNTTLEGLAGLEPVRGPEQFITAGNASQLSDGASVCTVMNSTYAEKH 240 Query: 270 GLKPLGIFRGMVSYGCEPDEMGIGPVFAVPRLLKRHGLSVDDIGLWELNEAFAVQVLYCR 329 ++P+GIFRG GCEPDEMGIGPV+A+PRLL+R+GL++DDI LWELNEAFA QV+YCR Sbjct: 241 NIEPMGIFRGFAVAGCEPDEMGIGPVYAIPRLLERNGLTMDDIDLWELNEAFASQVIYCR 300 Query: 330 DKLGIDPEKLNVNGGAISVGHPYGMSGARLAGHALIEGRRRKAKYAVVTMCVGGGMGSAG 389 D+LGI EKLNVNGG+IS+GHP+G++GAR GHALIEG+RR AKY V+TMC+GGG G+AG Sbjct: 301 DRLGIPMEKLNVNGGSISIGHPFGVTGARQTGHALIEGKRRGAKYVVITMCIGGGQGAAG 360 Query: 390 LFEI 393 LFE+ Sbjct: 361 LFEV 364 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 478 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 365 Length adjustment: 30 Effective length of query: 365 Effective length of database: 335 Effective search space: 122275 Effective search space used: 122275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory