Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate GFF2761 HP15_2705 inner-membrane translocator
Query= uniprot:G8ALI9 (505 letters) >FitnessBrowser__Marino:GFF2761 Length = 335 Score = 157 bits (398), Expect = 4e-43 Identities = 100/332 (30%), Positives = 168/332 (50%), Gaps = 19/332 (5%) Query: 154 IAVVVALAFPFTPLADRQLLDIGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYS 213 + +V+ AF P + + I+ T + GLN++VG AG + LG+ F+ +GAY Sbjct: 18 LILVILPAFLGNPFHYELVTQMAIIAATVV----GLNLLVGFAGQISLGHAGFFGLGAYF 73 Query: 214 YALLAHYFGFSFWVCLPLAGFLAAMSGVLLGFPVLRLRGDYFAIVTLGFGEIIRIILINW 273 + +G+S L + + ++G P+LRL+G Y ++ TL G II IIL N Sbjct: 74 TGIATGTYGWSSVPALVVGAIVVGAIAWIVGRPILRLKGHYLSMATLAVGFIIAIILNNE 133 Query: 274 YQFTGGPNGISGIPRPSFFG--IADFTRTPAEGTAAFHEMFGLEFSPLHRIIFLYYLILV 331 TGGP+G+ +P FG ++ F R + +FG+ Y V Sbjct: 134 RALTGGPDGMP-VPAFEIFGWELSAFGR---------YSLFGITIEGFQA---WYIFASV 180 Query: 332 LALVVNLFTMRVRKLPLGRAWEALREDDIACASLGINRTNMKLAAFAIAAMFGGFAGSFF 391 + LV F + + + P+GRA ++ ++A + +G+N K F I+A++ GS + Sbjct: 181 VLLVAVWFALNLIESPIGRALRSVHGSEVAASVVGVNTAKYKSLVFVISAIYASLMGSLY 240 Query: 392 ATRQGFISPESFTFIESAIILAIVVLGGMGSQIGVVVAAFLVIGLPEAFRELADYRMLAF 451 A QGFI+P +F S + + +VVLGGMGS GV++ A ++ LP+ + + + F Sbjct: 241 AHFQGFITPAVASFEFSILFITMVVLGGMGSTFGVILGAVVLKLLPQVLADFQELEHVMF 300 Query: 452 GMGMVLIMLWRPRGLLAHRDPTILLHGRPKGG 483 G+ ++L M++ P+GLL + R K G Sbjct: 301 GLILMLTMIFMPKGLLPTLTAFVSKKMRKKAG 332 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 335 Length adjustment: 31 Effective length of query: 474 Effective length of database: 304 Effective search space: 144096 Effective search space used: 144096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory