Align ABC transporter for D-Alanine, permease component 2 (characterized)
to candidate GFF2245 HP15_2195 amino acid ABC transporter, permease protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5403 (375 letters) >FitnessBrowser__Marino:GFF2245 Length = 395 Score = 433 bits (1114), Expect = e-126 Identities = 218/375 (58%), Positives = 283/375 (75%) Query: 1 VRAWVFQVVTVVAVIALGWFLFDNTQTNLQHRGITSGFGFLERSAGFGIAQHLIDYTEAD 60 VR+ FQ V + V GW L DNT +N++ RGI++GFGFL +AGFGI +L+ Y Sbjct: 21 VRSLFFQAVAIALVFWGGWILVDNTLSNMESRGISTGFGFLGETAGFGIIMNLVPYDATM 80 Query: 61 SYARVFLIGLLNTLLVTFIGVILATILGFIIGVARLSQNWIISKLATVYVEVFRNIPPLL 120 SY R F +GL NTLLV+ +GV+ ATILGFIIGVARLS NW+++K+A VY+EV RNIP LL Sbjct: 81 SYGRTFWVGLTNTLLVSAMGVVAATILGFIIGVARLSSNWLVAKMALVYIEVIRNIPLLL 140 Query: 121 QILFWYFAVFLSMPGPRAAHNFGDTFFVSSRGLNMPAALVAEGFWPFVISVVLAIVAIVL 180 QI FWYFAV ++P PR + + G F+++RGL +P + EGF ++LAI A+V Sbjct: 141 QIFFWYFAVLSNLPSPRQSVDVGGALFLNNRGLYLPDPVTQEGFGIVWGGILLAIAAVVG 200 Query: 181 MTRWANKRFEATGEPFHKFWVGLALFLVIPALSALLFGAPVHWEMPELKGFNFVGGWVLI 240 + WA KR ATG+ F F VG+A+ +++P +S L+ G P+ W++P L+GFNF GG +I Sbjct: 201 IRIWAKKRQLATGQIFPTFKVGVAILVLVPIISYLVAGRPLEWDLPALRGFNFGGGITII 260 Query: 241 PELLALTLALTVYTAAFIAEIVRSGIKSVSHGQTEAARSLGLRNGPTLRKVIIPQALRVI 300 PEL AL +AL++YTA+FIAEIVRSGI SVS GQTEA+++LGL NG TLR V+IPQA+RVI Sbjct: 261 PELAALWIALSLYTASFIAEIVRSGILSVSKGQTEASKALGLPNGLTLRLVVIPQAMRVI 320 Query: 301 IPPLTSQYLNLAKNSSLAAGIGYPEMVSLFAGTVLNQTGQAIEVIAITMSVYLAISISIS 360 IPPLTSQYLNL KNSSLA IGYP++V++F GT LNQTGQA+EV+AITM+VYL IS+ IS Sbjct: 321 IPPLTSQYLNLVKNSSLATAIGYPDLVAVFMGTTLNQTGQAVEVVAITMAVYLTISLLIS 380 Query: 361 LLMNWYNKRIALIER 375 L MN YN+ +A+ ER Sbjct: 381 LFMNIYNRAVAIKER 395 Lambda K H 0.328 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 500 Number of extensions: 31 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 395 Length adjustment: 30 Effective length of query: 345 Effective length of database: 365 Effective search space: 125925 Effective search space used: 125925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory