Align D-alanine dehydrogenase (EC 1.4.99.-) (characterized)
to candidate GFF1637 HP15_1596 D-amino acid dehydrogenase 2 small subunit
Query= reanno::acidovorax_3H11:Ac3H11_4848 (445 letters) >FitnessBrowser__Marino:GFF1637 Length = 406 Score = 230 bits (586), Expect = 7e-65 Identities = 150/426 (35%), Positives = 216/426 (50%), Gaps = 28/426 (6%) Query: 1 MKTI-VLGAGIIGISTAWHLLERGHEVIVIDRQPDAALETSFANAAQISVSYCEPWANRE 59 MK I V+G GI GI+TA+ L +RG +V V ++ AA+ETSFAN Q+S S E W N + Sbjct: 1 MKRIAVIGGGITGITTAYTLAKRGLDVTVYEKHRYAAMETSFANGGQLSASNAEVWNNWQ 60 Query: 60 APLKALKWMFDKEAPLLFRPQMDWQQWRWGLQFLAQCNDTAFERNVQQIVALGAYSHAAL 119 +K +KWM ++APLL P+ W + W +F+A +E+N + L + L Sbjct: 61 TVMKGIKWMSRRDAPLLVNPKPSWHKLSWFAEFIAAI--PQYEKNTTETARLAIAARDHL 118 Query: 120 KDLVGTTGIEYNRLERGIAHFYTDQKSFDAAGHAVELMRKHGVQRRLVSRDELLQIEPAF 179 GI+++ ++GI H Y D+ FD A L+ G++RR V+ +E+ IEP Sbjct: 119 FAWAQEEGIDFDLKKQGILHIYRDKAGFDHAEKVSRLLAAGGLERRSVTPEEMKSIEPTL 178 Query: 180 RAYGDKITGGTYTSTDESGDARVFTQELARRCIARGAQFLYGHDVLRLNKIGNAIDSVAV 239 GG +T +D +GD FT LA G + YGH V L +A + A Sbjct: 179 ---AGNYYGGFFTESDSTGDIHKFTNGLADAIKRLGVKTCYGHTVTEL----SADERNAW 231 Query: 240 MARQPGGGGKKDFILKADAVVVACGSYSAPLLRSVGVDLPIYPGKGYSATFPL---LRPE 296 + G +D D VV+ G S L + +G + IYP KGYS T L + Sbjct: 232 VTAHDGTEQSRDTF---DGVVICAGVGSRGLAKKLGDRVNIYPVKGYSITVELDDEASQK 288 Query: 297 GAPMVSTIDDGKKIAMSRLGN-HLRVAGTIELNGWDLTLDSSLARARCHMLSRRIEAILP 355 AP VS +DD KI SRLG+ RVAGT E +G++ + R L+R +E P Sbjct: 289 AAPTVSLLDDATKIVTSRLGDGRFRVAGTAEFSGYNRDIKDD----RIRPLTRWVEQCFP 344 Query: 356 GVCDTRTPEEGGDPQYWTGLRPATPTNIPFIGRTRVGKLWVNAGHGTLGWTHGAGSGKAL 415 GVC + W GLRP P +P +G R+ ++ N GHG LGWT A + + + Sbjct: 345 GVCTRKVVP-------WAGLRPMLPNMMPRVGPGRLPTVFYNTGHGHLGWTLSAITAELV 397 Query: 416 AELISG 421 AE ++G Sbjct: 398 AESVTG 403 Lambda K H 0.321 0.137 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 27 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 406 Length adjustment: 32 Effective length of query: 413 Effective length of database: 374 Effective search space: 154462 Effective search space used: 154462 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory