Align Putative D-lactate dehydrogenase C713.03, mitochondrial; EC 1.1.2.4 (characterized)
to candidate GFF2609 HP15_2553 oxidoreductase, FAD-binding protein
Query= SwissProt::Q9C1X2 (526 letters) >FitnessBrowser__Marino:GFF2609 Length = 479 Score = 287 bits (734), Expect = 7e-82 Identities = 164/453 (36%), Positives = 256/453 (56%), Gaps = 18/453 (3%) Query: 77 TDPADLDAFNIDWMNKYRGKTQLALKPKTTQQVSEILKYCNQKKLAVVPQGGNTGLVGGS 136 TDPADLD + DW Y K PKTT+QV ++K+ N+ ++A+VP GG TGL G+ Sbjct: 37 TDPADLDTYGKDWTKIYPPKPLAIALPKTTEQVQALVKFANENQVALVPSGGRTGLSAGA 96 Query: 137 VPVFDEIVLNLGLMNQIHTFDEISGVITLDSGVILENADNFLAEKGYMFPLDLGAKGSCQ 196 V E+V+ MNQI F+ + +GV+ E N + G +P+D + GS Q Sbjct: 97 VAANGEVVVAFDNMNQILDFNASDRTVRCQAGVVTEQLQNCAEDNGLYYPVDFASAGSSQ 156 Query: 197 VGGCAATAAGGLRLLRYGSLHGSILGMEAVLPDGTILDNLVTLRKDNTGLDIKQLFIGSE 256 +GG +T AGG++++RYG + G++ V G ILD L K+NTG D++ LFIG+E Sbjct: 157 LGGNLSTNAGGIKVIRYGMSRDWVAGLKVVTGKGDILDLNKDLEKNNTGYDLRHLFIGAE 216 Query: 257 GYLGVITKLSVICPKRPSSTNVAFFGVPSYENVLKAFSETRSHLTEILSAFELMDNTSQT 316 G LG IT+ ++ ++P + V G+ N + + + L+A+E + + Sbjct: 217 GTLGFITEATMKLSRKPDNLTVLVLGLNDLTNTMDVLQTFQKKID--LTAYEFFSHQAMG 274 Query: 317 LVDKYSGTQRPLEDEHPFYVLVETQGSNKEHDEQKITALVEDLLEKEIISDGVLAQDESQ 376 V + Q P E E P+Y L+E + + + + + AL E +E + DGV++Q E+Q Sbjct: 275 HVLAHGQVQAPFETEAPYYALLEFESVSDQVMDDAM-ALFEQCVENGWVLDGVISQSETQ 333 Query: 377 LRVLWERREGITECLAKAGSGVYKYDVSLPLPVLYDLVNDTKKRLIEFNLLDDTPEHPVI 436 + LW+ RE I+E +A YK D+S+ +V+ L E + + T +P Sbjct: 334 AQNLWQLRERISESIAPRTP--YKNDISV-------VVSKVPGFLQEIDAV-VTEHYPDF 383 Query: 437 DVVGFGHMGDGNLHLNIAVRQ---FDKRVEKC--LEPWVYEWVSRHRGSISAEHGLGLLK 491 +++ FGH+GDGNLHLNI + + EKC + WV+E V R++GS+SAEHG+G+ K Sbjct: 384 EIIWFGHIGDGNLHLNILKPEDMANEDFFEKCQQVNKWVFEIVERYQGSVSAEHGVGMTK 443 Query: 492 KPFVGYSKSKEMIHLMKTLKNVFDPNGIMLPYK 524 KP++ Y++S+ I ++ +K VFDPNGIM P K Sbjct: 444 KPYLQYTRSEAEIAYLRGIKQVFDPNGIMNPGK 476 Lambda K H 0.319 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 604 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 526 Length of database: 479 Length adjustment: 34 Effective length of query: 492 Effective length of database: 445 Effective search space: 218940 Effective search space used: 218940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory