Align D-lactate transporter, permease component 1 (characterized)
to candidate GFF951 HP15_930 branched-chain amino acid transport permease
Query= reanno::Phaeo:GFF1249 (400 letters) >FitnessBrowser__Marino:GFF951 Length = 331 Score = 171 bits (434), Expect = 2e-47 Identities = 113/334 (33%), Positives = 164/334 (49%), Gaps = 51/334 (15%) Query: 5 NKKDKTLLLVVAILTLFAPFILNPFPTGSALAQFNAGYPDLMQRFVIFGIFAIGFNILFG 64 ++K L V+ +L L APF++ YP + + + F +FA+ FN+LFG Sbjct: 22 DRKKMMLNGVLLLLLLAAPFMI---------------YPVFLMKILCFALFAVAFNLLFG 66 Query: 65 LTGYLSFGHAAFLGVGSYSAVWMFKLLS-MNVVPAIVLSVIVAGLFALVIGYVSLRRSGI 123 TG LSFGHAAFL G Y+ ++ S ++ I+ + A + +S+RR GI Sbjct: 67 FTGLLSFGHAAFLATGGYTTGYLLSNYSGLSTEMGIIAGTLAATVLGTGFALLSIRRQGI 126 Query: 124 YFSILTLAFAQMSFNLAYSVLTPITNGETGLQLTLDDPRVLGVSATADGSIPVTSLFG-L 182 YF+++TLA AQ+ F + V + T GE G+ IP L G + Sbjct: 127 YFAMVTLALAQLVF--FFFVQSEFTGGEDGMH-----------------GIPRGELLGFI 167 Query: 183 EMRSTFEMVVGPWAFQFNAGYYLCALILLAAFYLSIRIFRSPFGLMLKAVKSNQQRMNYT 242 + M YY + +A + L RI SPFG +LKA+K N+ R Sbjct: 168 NLEDNLNM------------YYFVLAVFIACYLLVQRIVGSPFGQVLKAIKQNEPRAVSL 215 Query: 243 GLNTRPYTLAAFVISGMYAGLAGGLMASMDPLAGAERMQWTASGEVVLMTILGGAGTLIG 302 G N Y + AFVIS AGLAG + + + LA W SGEV+LMT++GG GTL+G Sbjct: 216 GYNVDRYKVLAFVISAALAGLAGSMKSVVFQLASLNDAHWHMSGEVILMTLVGGMGTLLG 275 Query: 303 PVLGAGFIKYFENIFSKINDNVLHSWFSFMPDGI 336 PV+GA F+ NI +++ L W + GI Sbjct: 276 PVVGATFV---VNIEYQLSQGALRDWVDPILGGI 306 Lambda K H 0.327 0.143 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 33 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 331 Length adjustment: 29 Effective length of query: 371 Effective length of database: 302 Effective search space: 112042 Effective search space used: 112042 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory