Align D-lactate transporter, substrate binding component (characterized)
to candidate GFF2199 HP15_2153 extracellular ligand-binding receptor
Query= reanno::Phaeo:GFF1251 (448 letters) >FitnessBrowser__Marino:GFF2199 Length = 415 Score = 181 bits (459), Expect = 4e-50 Identities = 125/412 (30%), Positives = 204/412 (49%), Gaps = 36/412 (8%) Query: 27 IFTASSAAAFTNEPTGSTVTLGFNVPQTGPYADEGADELRAYQLAVEHLNGGGDGGMMNT 86 +F+A + T+ +G N PQTG Y D+G + LAV+ +N G Sbjct: 7 LFSACLLLLASTTVYAETLKIGLNYPQTGRYKDQGLQQRLGAFLAVDEINKAG------- 59 Query: 87 FSSKALQGNGIMGKEVKFVTGDTQTKSDAARASAKSMIEKDGAVMITGGSSSGVAIAVQG 146 G+MG++++ V +T+ + +I+++G M+ GG SS VAIA Sbjct: 60 ---------GVMGRQLELVIRNTRGDPAQGAKNTAELIDREGVQMVFGGVSSAVAIASGK 110 Query: 147 LCQEAGVIFMAGLTHSNDTTGKDKKANGFRHFFNGYMSGAALAPVLKNLYGTDRNAYHLT 206 ++ I+ LT+SN TTG + + FR +N +M+ AL+ L + D + +++T Sbjct: 111 AARDRNRIYFGTLTYSNATTGAEGHSYMFREPYNAWMTAKALSQYLTTNHAED-DYFYIT 169 Query: 207 ADYTWGWTQEESIAAATEALGWNTVNKVRTPLAA--TDFSSYIAPVLNSGADVLVLNHYG 264 ADYTWGW+ EES+ + + V+TP TDF + S A VL++ +G Sbjct: 170 ADYTWGWSVEESVRKFSGTEDTDRHQGVKTPFPGHITDFREALEQAEASNAKVLMMVLFG 229 Query: 265 GNMVNSLTNAVQFGLREKVVNGKNFEIVVPLYSRLMAKGAGANV-KGIHGSTNWHWSLQD 323 +MV +L A + GL +K+ +IVVP + MA+ G + +G+ G + W W++ Sbjct: 230 DDMVRALNVAYEMGLTKKM------QIVVPNLTLGMARQVGPTIMEGVIGGSPWVWNVPY 283 Query: 324 E----GSQAFVRSFGSKYGFPPSQAAHTVYCQTLLYADAVERAGSFNPCAVVEALEGFEF 379 E + FV +F ++Y PS AA + Y Y DAVER G+ N +++ ALEG + Sbjct: 284 ELNYPRGKEFVEAFSARYEMRPSTAAASAYSIVYQYKDAVERTGTTNTASLIRALEGHRY 343 Query: 380 DGLGNGKTLYRAEDHQCFKDVLVVRGKENPT---SEF--DLLEVVEVTPAEQ 426 L + +R DHQ + V VV+ K T E+ D +++ P +Q Sbjct: 344 TFL-KDEQYWREFDHQNVQTVYVVKVKPRNTIIADEYSSDYFSIIDSMPGDQ 394 Lambda K H 0.315 0.131 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 448 Length of database: 415 Length adjustment: 32 Effective length of query: 416 Effective length of database: 383 Effective search space: 159328 Effective search space used: 159328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory