GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Marinobacter adhaerens HP15

Align N-Acetyl-D-Glucosamine phosphotransferase system transporter, component of N-acetyl glucosamine-specific PTS permease, GlcNAc IIBC/GlcNAc I-HPr-IIA (characterized)
to candidate GFF475 HP15_463 fused phosphoenolpyruvate-protein phosphotransferase PtsP/GAF domain protein

Query= TCDB::Q9HXN5
         (842 letters)



>lcl|FitnessBrowser__Marino:GFF475 HP15_463 fused
           phosphoenolpyruvate-protein phosphotransferase PtsP/GAF
           domain protein
          Length = 768

 Score =  274 bits (701), Expect = 1e-77
 Identities = 192/624 (30%), Positives = 319/624 (51%), Gaps = 21/624 (3%)

Query: 222 IMGLGVAEQDEVEVICRGEDSEAALGALLAALASATAGAPKDAPRAIAPGEPARPAAVAG 281
           ++G+ V +Q E    C  E  EA L  + A LA   A +  +A  AI+        A   
Sbjct: 121 VLGVLVVQQRESSR-CFDEGEEAFLVTVSAQLAGVIAHS--EATGAISGLSLTGEEAHDV 177

Query: 282 TLAGVCASPGLASGPLARLGAISLPADDGRHRPEEQHLALDQAL-------QRVRDDVQG 334
           +  GV  +PG+A G     G +  P+ D    PE+    +DQ L       + VR+D++ 
Sbjct: 178 SFNGVPGAPGVAIGN----GVVVYPSADLDVVPEKPTDDIDQELALFGASVKAVREDIER 233

Query: 335 SLQQARLGGDENEAAIFSAHLALLEDPGLLDAADMLIDQGVGAAHAWHRAIQAQCEILQA 394
             ++        E A+F  +L +L D  +       I +G+ A  A  + +Q      + 
Sbjct: 234 VAKRLASQLRPEEQALFDVYLRMLGDDAMPGEVSNKIREGIWAQGALKQVVQQYIRHFEM 293

Query: 395 LGNLLLAERANDLRDLEKRVLRVLL-GDTAPLRVPAGAIVAAREITPSDLAPLVDAGAAG 453
           + +  L ERA D+RDL +R+L  L  G+   L  P   ++ + E+TP+ L  +      G
Sbjct: 294 MDDHYLQERAVDIRDLGRRLLSHLQEGEQKHLNYPERTVLVSEELTPAMLGEVPKGQLVG 353

Query: 454 LCMAEGGATSHVAILARSKGLPCLVALGAGLLELEEGRQVVLDAGQGRLELSPDARRLEQ 513
           L   +G + SHVAILAR+ G+P ++ L    +   +G+++++D  +G++  SP A     
Sbjct: 354 LVSVKGSSNSHVAILARAMGVPTVMGLVDIPVNQLDGKELIVDGFEGQIFASPSADLRSY 413

Query: 514 VALQVAQREEQRRRQQADAQREALTRDGRRIEIGANVASPREAAEAFANGADGVGLLRTE 573
                 + +E  R  +    +   T D  R+ +  N     +   + ++GA+G+GL RTE
Sbjct: 414 YQAICDEEDELIRGLEVLKDKPCETTDHHRVSLLVNTGLMTDVVRSLSHGAEGIGLYRTE 473

Query: 574 FLFLERRAAPDEEEQRNAYQEVLDAMGQRKVIIRTIDVGGDKHLDYLPLPVEENPALGLR 633
             F+ +   P E+EQR  Y+E L+A     V +RT+D+GGDK L Y P+  EENP LG R
Sbjct: 474 VPFMIKDRFPSEQEQREYYREQLEAFAPSPVTMRTLDIGGDKALTYFPIQ-EENPFLGWR 532

Query: 634 GIHLGQARPELLDQQLRALLRV-EPLERCRILLPMVSEVDE----LRAIRRRLGELATQL 688
           GI +    PE+   Q+RA+L+  E L   +I+LPM+S + E    L  I R   E+  + 
Sbjct: 533 GIRVTLDHPEIFLVQVRAMLKASEGLNNLQIMLPMISNISEVEESLHLIYRVYHEVREEG 592

Query: 689 GIERLPELGVMIEVPSAALLADQLAEHADFLSIGTNDLSQYALAMDRCHAGLADRIDALH 748
               +P++GVM+E+P+A     +LA+  DFLS+G+NDL+QY LA+DR +  +A    + H
Sbjct: 593 YDIHMPKVGVMVEIPAAVYQIRELADRVDFLSVGSNDLTQYLLAVDRNNPRVAQLYHSYH 652

Query: 749 PALLRLIAQTCAGAARHGRWVGVCGALASDPLATPVLVGLGVEELSVGPNLVGEIKTRVR 808
           PA+L+ + +    A   G+ VG+CG LA DP    +L+ +G + LS+    + ++K+ +R
Sbjct: 653 PAVLQALVRIAQDAHSVGKPVGICGELAGDPGGALLLMAMGYDSLSMNAASLPKVKSVIR 712

Query: 809 QLDAAECRRHAQALLDLGSARAVR 832
            +      +  + +L L S   ++
Sbjct: 713 SVSREWAIQLLEDVLLLDSPHVIK 736


Lambda     K      H
   0.319    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1284
Number of extensions: 59
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 842
Length of database: 768
Length adjustment: 41
Effective length of query: 801
Effective length of database: 727
Effective search space:   582327
Effective search space used:   582327
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory