GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Marinobacter adhaerens HP15

Align 4-hydroxybutyrate-CoA ligase (EC 6.2.1.40) (characterized)
to candidate GFF2651 HP15_2595 acyl-CoA synthetase

Query= BRENDA::A4YDR9
         (549 letters)



>lcl|FitnessBrowser__Marino:GFF2651 HP15_2595 acyl-CoA synthetase
          Length = 547

 Score =  270 bits (689), Expect = 1e-76
 Identities = 173/536 (32%), Positives = 273/536 (50%), Gaps = 21/536 (3%)

Query: 19  YSVLTPLLFLERAGKYFKDKTAVVYRDSRYTYSTFYDNVMVQASALMRRGFSREDKLSFI 78
           Y +L   L L    +Y  D+  V    S+YTY+   + +   A+AL   G    D ++ +
Sbjct: 16  YPLLIKRLLLS-GPRYNPDQEIVYSNRSKYTYTDLVERIHRLANALTDAGVKPGDTVAVM 74

Query: 79  SRNRPEFLESFFGVPYAGGVLVPINFRLSPKEMAYIINHSDSKFVVVDEPYLNSLLEVKD 138
             + P +LE FF +P  G +L  +N RLSP ++ Y +NH++   V+V + +L  +  VKD
Sbjct: 75  DWDTPRYLECFFAIPMIGAILHTVNIRLSPDQIVYTMNHAEDDVVLVHDDFLPIIEAVKD 134

Query: 139 QIKA--EIILLEDPDNPSASETARKEVRMTYRELVKGGSRDPLPIPAKEEYSMITLYYTS 196
           +IK     I L D DN   ++ A  E    Y +L+   + D    P  +E S+ T +YT+
Sbjct: 135 EIKTVKTWIQLTDSDN---AQQAPVEAVGEYEDLL-ARANDKFDFPDFDENSVATTFYTT 190

Query: 197 GTTGLPKGVMHHHRGAFLNAMAEVLE----HQMDL---NSVYLWTLPMFHAASWGFSWAT 249
           GTTG PKGV   HR   L+ +A         +M L   +SVY+   PMFH  +WG  +A 
Sbjct: 191 GTTGNPKGVYFSHRQLVLHTLAMTGTVASFDEMPLMRSSSVYMPVTPMFHVHAWGVPYAA 250

Query: 250 VAVGATNVCLDKVDYPLIYRLVEKERVTHMCAAPTVYVNLADYMKRNNLKFSNRVHMLVA 309
             +G   V   + +  L+  L+++ +VT     PT+   +           SN  H+L+ 
Sbjct: 251 TMMGIKQVYPGRYEPELLVDLLKEHKVTFSHCVPTIMQMMMATESIKTADLSNW-HVLIG 309

Query: 310 GAAPAPATLKAMQEIGGYMCHVYGLTETYGPHSICEWRREWDSLPLEEQAKLKARQGIPY 369
           G+A       A  ++G  +   YG++ET         + E   LPLE+Q  ++ + GI  
Sbjct: 310 GSALTKGLCDAGAKLGIKLYTAYGMSETCPLLCASHLKPEDLELPLEQQTAIRVKTGIAT 369

Query: 370 VSFEMDVFDANGKPVPWDGKTIGEVVMRGHNVALGYYKNPEKTAESFRDGWFHSGDAAVV 429
              E+++ D  G PVP DG+  GE+V R   +  GY+K PEK  + +  GW H+GD A +
Sbjct: 370 PMVELEIVDPEGNPVPHDGEAKGEIVARAPWLTQGYFKEPEKGEQLWEGGWLHTGDVASM 429

Query: 430 HPDGYIEIVDRFKDLINTGGEKVSSILVEKTLMEIPGVKAVAVYGTPDEKWGEVVTARIE 489
            PD  I I DR KD+I TGGE +SS+ +E  + +   V   AV G PDEKWGE   A + 
Sbjct: 430 EPDNTITIKDRIKDVIKTGGEWLSSLDLENLISQHSAVAGAAVVGVPDEKWGERPHALVT 489

Query: 490 LQEGVKLTEEEVIKFCKE-----RLAHFECPKIVEF-GPIPMTATGKMQKYVLRNE 539
           L+ G + + E++    K+      +  +  P+ ++F   IP T+ GK+ K ++R++
Sbjct: 490 LKPGEQASAEDIQNHLKQFVESGEINKWAIPEHIDFVEDIPKTSVGKINKKLIRDQ 545


Lambda     K      H
   0.319    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 745
Number of extensions: 37
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 549
Length of database: 547
Length adjustment: 36
Effective length of query: 513
Effective length of database: 511
Effective search space:   262143
Effective search space used:   262143
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory