Align Transporter, component of The methionine/alanine uptake porter, MetPS (Trotschel et al., 2008) (MetP is the transporter; MetS is an essential auxiliary subunit) (characterized)
to candidate GFF2680 HP15_2624 sodium-dependent transporter family protein
Query= TCDB::Q8NRL8 (579 letters) >FitnessBrowser__Marino:GFF2680 Length = 470 Score = 200 bits (509), Expect = 9e-56 Identities = 147/465 (31%), Positives = 227/465 (48%), Gaps = 50/465 (10%) Query: 33 RREVFSSRSVFILAAIGSAVGLGNIWRFPYVAYDNGGGAFLIPYAIALLTAGIPLLFLDF 92 +R ++SSR FILAA GSAVGLGNIW+FPYV +NGGGAF++ Y + + GIP++ + Sbjct: 21 QRGLWSSRLAFILAATGSAVGLGNIWKFPYVTGENGGGAFVLVYLLCIAVVGIPIMMAEV 80 Query: 93 AIGHRYRGSAPL-------AFRRFKKQTETIGWIQVGIAFFITIYYAAIIGWAGLYAFKS 145 IG R G +P+ R K + +G I + F I +Y+ I GWA Y + Sbjct: 81 MIGRR-GGRSPVKSLSLIAEHDRLKPAWKLVGAIGILAGFLILSFYSVIGGWAISYVGTT 139 Query: 146 LN-KAWGADPDTY--FFSDFLNFDSEAVVSMDIVPQIAIALFIVWIAAIVVLAI-GVDKG 201 + + G DT FS L+ P +A +++A ++V+ + GV G Sbjct: 140 ASGQLAGQSADTVGAVFSGLLS-----------DPTKLLAWHTLFMAMVMVVVVRGVRSG 188 Query: 202 IGRVSMVFMPLLVIIFLIVVIQAVLLPGAEIGLDALFTPNWEALKNPTVWIAAYGQIFFS 261 + R + MP L ++ LIVV A+ LF P++ L + + A G FF+ Sbjct: 189 LERAVSILMPALFVLLLIVVGYAMTTGHFGQAAAFLFQPDFSKLTTSGI-LVALGHAFFT 247 Query: 262 LSVGFGIMLTYSSYLKPRTNLTSTGLVTGFANSSFEVLAGIGVFAALGFMAANAGVGVDE 321 LS+G +M+ Y SYL ++ T + ++ +LAG+ +F + G Sbjct: 248 LSLGMAVMMAYGSYLPKNISIAKTSITVSVIDTGVALLAGLAIFPIVFANGLEPG----- 302 Query: 322 VATSGIGLAFVAFPAIINEMPLGGLFGFLFFSSLTIAGFTSLFSLLEVVVSAVKDKFGLN 381 +G GL F P +MP+G LFG LFF L A +TS SLLE +V ++++ G+N Sbjct: 303 ---AGPGLIFQTLPLAFGQMPMGSLFGTLFFVLLIFAAWTSGISLLEPIVEWLEERKGMN 359 Query: 382 RKATAIGVGVV------MALLSLGLFS---------TTSGLATLDIMDKFTNNIGIVAVA 426 R + +G G V ++LSL L+S G D++D FT NI + Sbjct: 360 RTVSTLGAGFVCWGLGIASILSLNLWSDFAPLGFVPMLEGKTIFDLLDFFTANIMLPLGG 419 Query: 427 LIAVVSIDWVLRRIDEFSTHLNAISAFKVNTIWRISVVNITTLVL 471 L+ + WV+ R + A+S N +W I+V IT + + Sbjct: 420 LLVALFAGWVMSR--QAMERELALSPAMFN-LWLITVRFITPVAV 461 Lambda K H 0.325 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 617 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 579 Length of database: 470 Length adjustment: 35 Effective length of query: 544 Effective length of database: 435 Effective search space: 236640 Effective search space used: 236640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory