Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate GFF42 HP15_42 short-chain dehydrogenase/reductase SDR
Query= reanno::BFirm:BPHYT_RS16920 (266 letters) >FitnessBrowser__Marino:GFF42 Length = 266 Score = 108 bits (270), Expect = 1e-28 Identities = 82/249 (32%), Positives = 120/249 (48%), Gaps = 10/249 (4%) Query: 22 LVDRTVLITGGATGIGASFVEHFAAQGARVAFFDIDASAGEALADELGDSKHKPLFLSCD 81 L ++ LITG GIG +F QGA V ++ GEA+A +L K LF D Sbjct: 4 LENKVALITGAGGGIGEGVARYFVKQGAAVIIAELSEQLGEAVAADLRAQGGKALFCHTD 63 Query: 82 LTDIDALQKAIADVKAALGPIQVLVNNA-ANDKRHTIGEVTRESFDAGIAVNIRHQFFAA 140 +++ +++ A+A G I VLVNNA A + E T E + + ++A Sbjct: 64 VSNKSSIENAVATAVDHFGSIDVLVNNAFAPTPNVKLEEKTDEMLTQTLNTTVWAAWWAM 123 Query: 141 QAVMEDMKAANSGSIINLGSISWMLKNGGYPVYVMSKSAVQGLTRGLARDLGHFNIRVNT 200 +A M GSI+N SI + + Y +KSA+ GLTR A + G FNIR N Sbjct: 124 KAAFPHMCERGGGSIVNFYSIDTEIGAWLHGDYNTAKSAILGLTRSAAAEWGRFNIRANA 183 Query: 201 LVPGWVMTEKQKRLWLDDAG--RRSIKE---GQCIDAELEPADLARMALFLAADDSRMIT 255 + P M +L ++ G RS G+C + E AD+ + FLA++ SR +T Sbjct: 184 IAP-TAMGATFHKLAAENPGFEERSAAMRPLGRCGEPE---ADIGPVVAFLASEMSRFVT 239 Query: 256 AQDIVVDGG 264 + I VDGG Sbjct: 240 GESIHVDGG 248 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 266 Length adjustment: 25 Effective length of query: 241 Effective length of database: 241 Effective search space: 58081 Effective search space used: 58081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory