Align L-arabonate dehydratase (EC 4.2.1.25) (characterized)
to candidate GFF3421 HP15_3363 dihydroxy-acid dehydratase
Query= reanno::Smeli:SM_b20890 (579 letters) >lcl|FitnessBrowser__Marino:GFF3421 HP15_3363 dihydroxy-acid dehydratase Length = 562 Score = 349 bits (896), Expect = e-100 Identities = 217/554 (39%), Positives = 317/554 (57%), Gaps = 21/554 (3%) Query: 19 GTGKNAIMHRSWMKNQGLPADTFDGRPIIGICNTWSELTPCNAHLRDLAERVKRGVYEAG 78 G GK+A R+ ++ G + F +P IGI +TWS LTPCN H+ LAE G EAG Sbjct: 20 GIGKSA--SRAMLRAVGFTDEDFK-KPQIGIASTWSNLTPCNMHINQLAEESAAGADEAG 76 Query: 79 GFPVEFPVFSTGESTLRPTAMMFRNLAAMDVE----ESIRG-NPVDGVVLLGGCDKTTPS 133 G + F + + T M +L + +V E++ G DG+V +GGCDK P Sbjct: 77 GKSLIFNTITISDGIANGTEGMKYSLVSREVIADSIETVAGCEGFDGLVAIGGCDKNMPG 136 Query: 134 LLMGAASVDIPAIVVSGGPMLNGKWRGKDVGSGTAIWQFSEMVKSGEMSLEEFMDAEQGM 193 +MG A ++ P++ V GG ++ G+ + A+ + G++ L E E+ Sbjct: 137 CMMGLARLNRPSVFVYGGTIMPGENHTDIISVFEAVGAHAR----GDLDLIEVKQIEETA 192 Query: 194 ARSAGSCMTMGTASTMASMAEALGMTLSGNAAIPAVDARRRVISQLTGRRIVEMVKEDLK 253 GSC M TA+TMAS EA+GM+L G++A AV + + G ++ ++++D+K Sbjct: 193 IPGPGSCGGMYTANTMASAIEAMGMSLPGSSAQNAVSETKAEDCRGAGAAVLNLLEKDIK 252 Query: 254 PSDILTKEAFENAIRVNGAVGGSTNAVLHLLALAGRVGVDLSLDDWDRLGRDVPTIVNLQ 313 PSDI+T++AFENAI V A+GGSTNAVLHLLA+A VGVDL L+D+ +G+ VP + +L+ Sbjct: 253 PSDIMTRKAFENAITVVIALGGSTNAVLHLLAMASTVGVDLELEDFVEIGKRVPVLADLR 312 Query: 314 PSGKYLMEEFYYAGGLPVVIKAVAEMGLLHNDAITVSGDTIWNDVKGVVNYNE--DVILP 371 PSG Y+M E GG+ ++K + + GLLH D +TV+G T+ ++ V Y E D+I Sbjct: 313 PSGHYMMSELVAIGGIQPLMKMLLDRGLLHGDCLTVTGQTLAENLADVDPYPEGQDIIHA 372 Query: 372 REKALTKSGGIAVLRGNLAPRGAVLKPSAASPHLMQHKGRAVVFESIEDYHARINREDLD 431 + + + +L GNLAP GAV K + GRA VF S E+ RI D Sbjct: 373 FDNPIKADSHLRILFGNLAPTGAVAKITGKEG--THFTGRARVFHSEEEAQERI--LDGT 428 Query: 432 IDETCIMVLKYCGPKGYPGMAEVGNMGLPPKVLKKGI-TDMIRISDARMSGTAYGTVILH 490 + ++V++Y GPKG PGM E+ + ++ KG+ +D+ I+D R SG ++G V+ H Sbjct: 429 VVAGDVLVIRYEGPKGGPGMREM--LSPTSAIMGKGLGSDVALITDGRFSGGSHGFVVGH 486 Query: 491 TAPEAAEGGPLALVENGDLIEVDIPNRTLHLHVSDEELARRRAAWVSPVKPLTGGYGGLY 550 PEAAEGGP+ALVE+GD I +D + + L VSD+EL RRR AW +P T G Y Sbjct: 487 ITPEAAEGGPIALVEDGDTITIDAVSNRIELDVSDQELERRRQAWQAPPPRFTRGTLAKY 546 Query: 551 IKTVMQADAGADLD 564 +TV A GA D Sbjct: 547 SRTVSSASKGAVTD 560 Lambda K H 0.318 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 895 Number of extensions: 53 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 579 Length of database: 562 Length adjustment: 36 Effective length of query: 543 Effective length of database: 526 Effective search space: 285618 Effective search space used: 285618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory