Align Xylose/arabinose import permease protein XacI (characterized, see rationale)
to candidate GFF3012 HP15_2956 sugar ABC transporter, permease protein
Query= uniprot:D4GP37 (309 letters) >FitnessBrowser__Marino:GFF3012 Length = 289 Score = 150 bits (378), Expect = 4e-41 Identities = 91/292 (31%), Positives = 156/292 (53%), Gaps = 31/292 (10%) Query: 23 RVAQYALVVFFLGFFLVPLETGIMTAIKTNESVARSLPFAPPVGEGFTLGNIQ------- 75 RVA Y L++ +L+PL ++T+ KT + A P + T+G + Sbjct: 13 RVAIYGLLLLAALVYLIPLFIMLVTSFKTPMDIRTGNLMALPT-DWTTIGWTKAWSEACT 71 Query: 76 -FALEQLSGSFFNSLIMSIPATIGSVLFGSMAAYGLTMVNWRAQMGMLMLFVVGVFVPYQ 134 E +SG F+NS M++PA + S L G+ Y L+ ++ + + G FVP+Q Sbjct: 72 GVQCEGISGYFWNSFKMTVPAVLISTLLGAFNGYVLSKWKFKGSDLFFGMLLFGCFVPFQ 131 Query: 135 AVLVPLARFWNNIFPLARMIEPMVASIPFFQGYHAELVPLVITHIAYGIPICTILFRSYY 194 VL+P+A + G LV+ H+ YG+ T+ FR+YY Sbjct: 132 VVLLPMAATLGKL------------------GLANTTSGLVLVHVIYGVAFTTLFFRNYY 173 Query: 195 QSLPNSLVEAGKIDGASITKIYRRIILPISKPMFGVVFIYQFTQIYNEFLFAFTLVTGSD 254 ++P++L++A ++DGA I+ RI+LP+S P+F V I+QFTQI+N+FLF +G Sbjct: 174 VAIPDALIKAARLDGAGFFTIFFRILLPMSTPIFMVSLIWQFTQIWNDFLFGVVFASGD- 232 Query: 255 APAAPVTLVLPAIGASTSGI-NFGIRMSAAFLAAVPTLILYVAFAEQFAKGL 305 + P+T+ L + +++G+ + + M+AA +AA+PTL++Y+ + F +GL Sbjct: 233 --SQPITVALNNLVNTSTGVKEYNVDMAAAMIAALPTLVVYIVAGKYFIRGL 282 Lambda K H 0.328 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 289 Length adjustment: 27 Effective length of query: 282 Effective length of database: 262 Effective search space: 73884 Effective search space used: 73884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory