Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate GFF3011 HP15_2955 ATP-binding component of ABC transporter
Query= uniprot:D4GP38 (383 letters) >FitnessBrowser__Marino:GFF3011 Length = 372 Score = 269 bits (687), Expect = 1e-76 Identities = 160/374 (42%), Positives = 216/374 (57%), Gaps = 20/374 (5%) Query: 1 MGQIQLTDLTKRFGDTV--AVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSG 58 M Q++L + K + + + +DI EFL+LVGPSGCGKST + +AGLET T G Sbjct: 1 MSQLELRSIRKTYPGVAEETLKGIDIDIASGEFLILVGPSGCGKSTLMNTIAGLETITDG 60 Query: 59 DIYIGGDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEV 118 I + G ++ P++RDIAMVFQ YALYP M+VR+NI FGL+ G E D+ V V Sbjct: 61 SIVLDGKDISTMEPKDRDIAMVFQSYALYPTMSVRENIAFGLKIR-GLPKHEIDQEVERV 119 Query: 119 AETLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQ 178 A+ L I+ L+++KP LSGGQQQRVA+GRA+ R P ++L DEPLSNLDAKLR EMRTE++ Sbjct: 120 ADLLQISPLMNKKPANLSGGQQQRVAMGRALARRPRIYLFDEPLSNLDAKLRVEMRTEIK 179 Query: 179 NLQDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEP 238 L +L T VYVTH+Q EAMT+ADRIAV+ DGELQQ+ +P E Y P NLFVA F+G P Sbjct: 180 KLHQRLKTTIVYVTHDQIEAMTLADRIAVLKDGELQQLGTPKEVYDRPENLFVAGFMGSP 239 Query: 239 MINLVRGTRSEST---------FVGEHFSYPLDEDVMESVDDRDDFVLGVRPEDIEVADA 289 ++ V T + G P+ E + + V + +LG+RPE I Sbjct: 240 AMSFVPVTVEQGEGGLQAEVRGNDGRSVKLPVPEFLADRVGKK--VILGIRPEHITQPQD 297 Query: 290 APDDAALDDHDLQMDVTVVEPHGDQNVLHLSHPDQPSADDALQAVTEGMHLVTRGDRVTV 349 +D L + + V EP G + + D + + H VT G+ + Sbjct: 298 QKNDQTLVAKG-EFTIEVTEPTGPDVIALIQ-----LNDTNVHCRIDPEHPVTWGETAEL 351 Query: 350 TIPPDKIHLFDAET 363 K+ FD ET Sbjct: 352 MFDMKKVVFFDPET 365 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 372 Length adjustment: 30 Effective length of query: 353 Effective length of database: 342 Effective search space: 120726 Effective search space used: 120726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory