Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate GFF1380 HP15_1347 sulfate/thiosulfate transporter subunit
Query= uniprot:D4GP39 (383 letters) >FitnessBrowser__Marino:GFF1380 Length = 362 Score = 209 bits (532), Expect = 1e-58 Identities = 119/304 (39%), Positives = 179/304 (58%), Gaps = 16/304 (5%) Query: 23 AVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRLEDRVLNGVSAQDRDI 82 A+ +I+L I DG+ L+GPSG GK+T LR++AGLET EG +R + + + +DR + Sbjct: 17 ALHDINLTIPDGQLTALLGPSGSGKTTLLRIIAGLETPEEGRIRFSGKDVTDLHVRDRRV 76 Query: 83 AMVFQSYALYPHKSVRGNMSFGL-----EESTGLPDDEIRQRVEETTDMLGISDLLDRKP 137 VFQ YAL+ H +V N++FGL +E G P EIR+RV++ +M+ + L DR P Sbjct: 77 GFVFQHYALFRHMTVAENVAFGLNVLPRKERPGKP--EIRKRVKDLLEMVQLEHLADRYP 134 Query: 138 GQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQGELGVTTVYVT 197 QLSGGQ+QR+AL RA+ PE+ L+DEP LDAK+R ++R L+ L EL T+V+VT Sbjct: 135 AQLSGGQKQRIALARAMAMRPEILLLDEPFGALDAKVRKDLRRWLRSLHDELHFTSVFVT 194 Query: 198 HDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFIGEPSMNLFDGSLSGDTF 257 HDQ EA+ + D+V V+ +G ++QV TPL+ Y RP++ FV F+G+ +N+ G + Sbjct: 195 HDQEEALELSDQVVVMSNGRIEQVDTPLELYGRPDSRFVFEFLGQ--VNVLSGKIRDGVM 252 Query: 258 R-GDGFDYPLSGATRDQLGGASGLTLGIRPEDVTVGERRSGQRTFDAEVVVVEPQGNENA 316 R GD + G D L +RP +V + + S + + G E Sbjct: 253 RQGDAWIRLPEGCENDD------AQLYLRPHEVRLTQSASDDAHLPFRIEAINLIGAEVR 306 Query: 317 VHLR 320 + L+ Sbjct: 307 IELK 310 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 362 Length adjustment: 30 Effective length of query: 353 Effective length of database: 332 Effective search space: 117196 Effective search space used: 117196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory