Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate GFF2759 HP15_2703 branched-chain amino acid ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >FitnessBrowser__Marino:GFF2759 Length = 454 Score = 126 bits (316), Expect = 9e-34 Identities = 70/222 (31%), Positives = 126/222 (56%), Gaps = 12/222 (5%) Query: 3 DLLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLV 62 ++L I+ + S+G ++ L V + IN GE+V+L+G NGAGKSTL+ ISG DRG + Sbjct: 220 EMLSIKGLVTSYGQIEVLHDVDIHINSGEIVSLVGANGAGKSTLLMTISGLQPTDRGAIT 279 Query: 63 FEGKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKKMMEESK 122 FEGK + + + + GI + + + DL ++ N+ L K ++M++ Sbjct: 280 FEGKDLSKITADQRVADGIVQVPEGRQVFKDLSVHDNLLLGAYTRGK----TPEVMDD-- 333 Query: 123 KLLDSLQIRIPDINMKVEN----LSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVEAR 178 L+ + + P + K N LSGGQ+Q +A+ RA+ +++L+DEP+ L+ + Sbjct: 334 --LERMYTKFPILRQKRHNLAGELSGGQQQMLAMGRALMAKPRLLLLDEPSMGLAPLIIE 391 Query: 179 KVLELARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKII 220 ++ + + LK++G+ + ++ N Q +ADR YVL+ GK++ Sbjct: 392 EIFNIVKELKEEGITIFLVEQNASQALALADRGYVLETGKVV 433 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 454 Length adjustment: 28 Effective length of query: 223 Effective length of database: 426 Effective search space: 94998 Effective search space used: 94998 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory