Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate GFF4157 HP15_4097 inner-membrane translocator
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__Marino:GFF4157 Length = 347 Score = 167 bits (424), Expect = 4e-46 Identities = 119/346 (34%), Positives = 174/346 (50%), Gaps = 30/346 (8%) Query: 93 ELDISTEKSFFHRHFLKIALIALLLYPMVVVAIKGPQGSLTYVDNFGIQILIYVMLAWGL 152 E D + S + +L L+ LL++P VV + Y+ G + I V+ GL Sbjct: 11 EADEAIWTSQTQKLWLGFFLLILLVFPFVVDS---------YLLYLGCLVGIAVISTTGL 61 Query: 153 NIVVGLAGLLDLGYVAFYAVGAYSYALLSSYFGLSFWVLLPLSGIFAALWGVILGFPVLR 212 NI+ G GL+ LG F VGAY+ A LS L F V L L+G+ AA G+++G P LR Sbjct: 62 NILTGFTGLISLGQAGFMGVGAYTVAWLSINTALPFPVTLVLAGLMAAAVGILVGLPSLR 121 Query: 213 LRGDYLAIVTLAFGEIIRLVLINWTDVTKGTFGISSIPKATLFGIPFDATAGGFAKLFHL 272 ++G YLAI TLA + + W VT G G+S P A LFG+ F + Sbjct: 122 VKGLYLAIATLAASVFLHFIFAEWESVTGGMGGLSLEP-AHLFGLTFQS----------- 169 Query: 273 PISSAYYKIFLFYLILALCMLTAYVTIRLRRMPIGRAWEALREDEIACRSLGINTVTTKL 332 ++++I+ L +L + R IGRA+ A+R+ +I+ LGIN + KL Sbjct: 170 -------DFMMYFIIVPLAVLMVLAARNVFRTRIGRAFIAIRDRDISAEILGINLLRYKL 222 Query: 333 TAFATGAMFAGFAGSFFAARQGFVSPESFVFLESAVILAIVVLGGMGSLTGIAIAAIVMV 392 +FA + +AG AG FA V+PESF S LA V++GGMG+L G + A M Sbjct: 223 MSFALSSFYAGIAGGLFAYFYRVVTPESFPLSMSIFYLAAVIVGGMGNLLGGILGAAFMT 282 Query: 393 GGTELLREMSFLKLIFGPDFTPELYRML--IFGLAMVVVMLFKPRG 436 E L+ ++ F P+ + ML IFG +V ++F+P G Sbjct: 283 LVPEALKLLTAALTPFYPNAPVFMSPMLEIIFGALIVGFLIFEPHG 328 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 34 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 347 Length adjustment: 31 Effective length of query: 432 Effective length of database: 316 Effective search space: 136512 Effective search space used: 136512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory