Align 4-aminobutyrate aminotransferase; EC 2.6.1.19; (S)-3-amino-2-methylpropionate transaminase; EC 2.6.1.22; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT (uncharacterized)
to candidate GFF349 HP15_347 glutamate-1-semialdehyde 2,1-aminomutase
Query= curated2:P63505 (449 letters) >FitnessBrowser__Marino:GFF349 Length = 426 Score = 120 bits (301), Expect = 8e-32 Identities = 107/342 (31%), Positives = 151/342 (44%), Gaps = 47/342 (13%) Query: 33 GVGVTLPVFVARAGGGIVEDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTC 92 GVG T P+F A G + D D R ID +G+ R+ DA+ QV Sbjct: 28 GVGGT-PIFFKHAQGAYLYDEDDQRYIDYIGSWGPMILGHGDQRIKDALHAQVDLGVG-- 84 Query: 93 FMVTPYEGYVAVAEQLNRITPGSGPKRSVLFNSGAEAVENAVKIARSYTGKPAVVAFDHA 152 P +A+++ + P R V NSG EA + V++AR YTG+ +V F+ Sbjct: 85 -YGAPTALETEMAKKVCELMPSIELVRMV--NSGTEATMSTVRLARGYTGRDKIVKFEGC 141 Query: 153 YHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLDKQLATNGELAAARAIG 212 YHG + S+ K+G G L P G+ A+ E Sbjct: 142 YHGHVD--------SLLVKAGSGALT-------LGVPNSPGIP----ASLAEHTITLTYN 182 Query: 213 VID------KQVGANNLAALVIEPIQGEGGFIVPAEGFLPALLDWCRKNHVVFIADEVQT 266 ID +++G + +AA+++EP+ G I P GFL L + C ++ V I DEV T Sbjct: 183 DIDSVRECFREMG-DQIAAIIVEPVAGNMNCIPPVPGFLEGLREVCDEHGTVLIFDEVMT 241 Query: 267 GF--ARTGAMFACEHEGPDGLEPDLICTAKGIADGLPLSAVTGRAEIMNAPHVGGLG--- 321 GF + GA +G G+ PDL K I GLP+ A G+ EIM H+ LG Sbjct: 242 GFRVSLGGA------QGLYGVTPDLTALGKVIGGGLPVGAFGGKREIME--HISPLGPVY 293 Query: 322 --GTFGGNPVACAAALATIATIESDGLIERARQIERLVTDRL 361 GT GNP+A A L T+ I G +R + V D L Sbjct: 294 QAGTLSGNPLAMCAGLTTLNAISEPGFHDRLTEKTNAVRDGL 335 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 449 Length of database: 426 Length adjustment: 32 Effective length of query: 417 Effective length of database: 394 Effective search space: 164298 Effective search space used: 164298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory