Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate GFF3087 HP15_3030 histidine/lysine/arginine/ornithine transporter subunit
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__Marino:GFF3087 Length = 256 Score = 204 bits (520), Expect = 1e-57 Identities = 108/244 (44%), Positives = 160/244 (65%), Gaps = 13/244 (5%) Query: 5 KNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVVNN-- 62 +++ K + VLK I+L ++G+ + +IG SGSGKST +RC+N LE +SG+++V+ Sbjct: 10 RDIYKTFDQLEVLKGISLETRKGDVVSLIGSSGSGKSTFLRCINLLETPTSGDIIVHGDP 69 Query: 63 --LVLNHKNK--------IEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEA 112 N K + +E+ R +MVFQ FNL+ HMTVL+N+ AP+ + K KKEA Sbjct: 70 IRFTTNRKGERIPADNKQVELIRAKLSMVFQSFNLWSHMTVLENIIEAPVHVLKVPKKEA 129 Query: 113 EETAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQ 172 E A YL VG+ ++ + YPA +SGGQQQR AIAR+L + +LFDEPTSALDPE + Sbjct: 130 IERAEAYLNKVGIYERKDYYPAQMSGGQQQRAAIARALAMEPEVMLFDEPTSALDPELVG 189 Query: 173 EVLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERA 232 EVL VM+ ++ + TM+VVTHEM FA++V+ +++F+ G I E+ P + F +P +ER Sbjct: 190 EVLKVMQGLAEEGR-TMIVVTHEMAFARDVSSQVLFLHQGVIEEQGTPEKVFDHPDSERM 248 Query: 233 RLFL 236 + FL Sbjct: 249 KQFL 252 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 256 Length adjustment: 24 Effective length of query: 218 Effective length of database: 232 Effective search space: 50576 Effective search space used: 50576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory