Align ABC-type permease for basic amino acids and glutamine (characterized, see rationale)
to candidate GFF2245 HP15_2195 amino acid ABC transporter, permease protein
Query= uniprot:Q31RP0 (377 letters) >FitnessBrowser__Marino:GFF2245 Length = 395 Score = 255 bits (651), Expect = 2e-72 Identities = 151/369 (40%), Positives = 216/369 (58%), Gaps = 15/369 (4%) Query: 12 WRDERLWRWVWQLLVLLVVGLGAIWLVDNLVYNLSQRGLSLSFDWLDQSAGFNIGESAIA 71 W D R+ +Q + + +V G LVDN + N+ RG+S F +L ++AGF I + + Sbjct: 16 WYDPRVRSLFFQAVAIALVFWGGWILVDNTLSNMESRGISTGFGFLGETAGFGIIMNLVP 75 Query: 72 YRTADSYARALVVGLVNSLRVIAIGLILTTVIGTLAGVAAFSENWLLRQLSRGYVAVVRN 131 Y SY R VGL N+L V A+G++ T++G + GVA S NWL+ +++ Y+ V+RN Sbjct: 76 YDATMSYGRTFWVGLTNTLLVSAMGVVAATILGFIIGVARLSSNWLVAKMALVYIEVIRN 135 Query: 132 TPLLLQLIVWYFPILLSLPAAQQPWHWLGSLYLSKQGIYLPWPQTPG-----WLVVILAI 186 PLLLQ+ WYF +L +LP+ +Q G+L+L+ +G+YLP P T W ++LAI Sbjct: 136 IPLLLQIFFWYFAVLSNLPSPRQSVDVGGALFLNNRGLYLPDPVTQEGFGIVWGGILLAI 195 Query: 187 ALVLFVS-WLAQRQRSP-------RDWRWLYGAIAVVTVLMLLTQLSWP-QQLQPGQIRG 237 A V+ + W +RQ + + + + +++ L+ L W L+ G Sbjct: 196 AAVVGIRIWAKKRQLATGQIFPTFKVGVAILVLVPIISYLVAGRPLEWDLPALRGFNFGG 255 Query: 238 GLRLSLEFTALLLGLVAYTGAFITEIIRGGILSVPAGQWEAAAALGLTRSQTLWQIVVPQ 297 G+ + E AL + L YT +FI EI+R GILSV GQ EA+ ALGL TL +V+PQ Sbjct: 256 GITIIPELAALWIALSLYTASFIAEIVRSGILSVSKGQTEASKALGLPNGLTLRLVVIPQ 315 Query: 298 ALRVIVPSLNSQYVGFAKNSSLAIAVGYPDLYATAQ-TTLNQTGRPVEVFLILMLTYLAI 356 A+RVI+P L SQY+ KNSSLA A+GYPDL A TTLNQTG+ VEV I M YL I Sbjct: 316 AMRVIIPPLTSQYLNLVKNSSLATAIGYPDLVAVFMGTTLNQTGQAVEVVAITMAVYLTI 375 Query: 357 NAVISAGMN 365 + +IS MN Sbjct: 376 SLLISLFMN 384 Lambda K H 0.326 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 395 Length adjustment: 30 Effective length of query: 347 Effective length of database: 365 Effective search space: 126655 Effective search space used: 126655 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory