Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate GFF2860 HP15_2804 oligopeptide/dipeptide ABC transporter, ATP-binding protein-like protein
Query= TCDB::Q9WXN4 (268 letters) >FitnessBrowser__Marino:GFF2860 Length = 672 Score = 167 bits (424), Expect = 4e-46 Identities = 97/243 (39%), Positives = 148/243 (60%), Gaps = 9/243 (3%) Query: 23 IEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPTSGE----IYFEGKDIWKDI 78 + AV+ +S E+ E + +VGESGSGK+ TA ++ LLPP + I F+G D+ Sbjct: 23 LHAVRGISLELNRGETLGIVGESGSGKSMTALALMNLLPPAAKRQASCIDFDGSDL-THA 81 Query: 79 KDRESLVEFR-RKVHAVFQDPFASYNPFYPVERTLWQAISLLENKPSNKKEALELIKESL 137 +RE + R +++ +FQ+P S NP Y + R L + ++L ++ + EA L Sbjct: 82 TERELASKIRGQRIGMIFQEPMTSLNPVYSIGRQLKETMTL--HRKVSDTEAENRAVYLL 139 Query: 138 FRVGI-DPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSMIDASSRGGIIKL 196 +VG+ DP L +YPH++SGGQ+QR+MIA + P L++ADEPT+ +D + + I+ L Sbjct: 140 EKVGLPDPASRLKQYPHELSGGQRQRVMIAMALMNEPELLIADEPTTALDVTIQAQILHL 199 Query: 197 LEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHPDKVVLEPTHEYTKLLVG 256 L EL++E G S+I ITHDLG+ +DNI VM G+IVE G +V+ P H YTK L+ Sbjct: 200 LRELQQEFGMSMILITHDLGVVSRAADNIAVMYAGDIVETGKTGEVLENPRHPYTKGLLE 259 Query: 257 SIP 259 +P Sbjct: 260 CVP 262 Score = 160 bits (404), Expect = 9e-44 Identities = 95/261 (36%), Positives = 158/261 (60%), Gaps = 19/261 (7%) Query: 4 LVVKNLTKIFSL--GFFSKRR-IEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLL 60 L V +++ FS+ G F KR+ ++A+ +VS +K+ E+++LVGESG GKTT + I+ L Sbjct: 353 LTVDHVSCTFSVRRGMFGKRKPLQALDDVSLTLKKGEVLALVGESGCGKTTLTRTIMGLQ 412 Query: 61 PPTSGEIYFEGKDIWKDIKDRESL--VEFRRKVHAVFQDPFASYNPFYPVERTLWQAIS- 117 P++G + G+ I E+L ++ R + +FQDP++S NP +T+ + I+ Sbjct: 413 APSTGSVTLNGQRI-------ENLPPMDRARMIQPIFQDPYSSLNP----RKTIGEIIAK 461 Query: 118 -LLENKPSNKKEALELIKESLFRVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPLLI 176 L + + +E + +++ + VG+ P V YP Q+SGGQ+QR I R IL P ++ Sbjct: 462 PLFVHGIGSNQEQHQQVRKMMELVGL-PSRVFNSYPDQLSGGQRQRAAIGRALILNPEVV 520 Query: 177 VADEPTSMIDASSRGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVER 236 + DEPTS +D S + I+ LL +LR+E + +F+TH+L + +++D + VM GEIVE Sbjct: 521 ICDEPTSALDVSVQAQILNLLLDLRDELDLTYLFVTHNLSVVQHMADRVAVMYLGEIVEC 580 Query: 237 GHPDKVVLEPTHEYTKLLVGS 257 G D+V+ +P H YT L+ S Sbjct: 581 GERDQVMSDPKHPYTHALMNS 601 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 268 Length of database: 672 Length adjustment: 32 Effective length of query: 236 Effective length of database: 640 Effective search space: 151040 Effective search space used: 151040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory