Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate GFF2860 HP15_2804 oligopeptide/dipeptide ABC transporter, ATP-binding protein-like protein
Query= TCDB::Q9WXN5 (330 letters) >FitnessBrowser__Marino:GFF2860 Length = 672 Score = 183 bits (465), Expect = 9e-51 Identities = 115/321 (35%), Positives = 177/321 (55%), Gaps = 9/321 (2%) Query: 5 LLKAENVRAYYKLEKVSVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLT 64 +L +++ + ++ AV G+S E+ E +G+VGESG GK+ ++ + MN++ P Sbjct: 6 ILDIQDLSVDIPTDSSTLHAVRGISLELNRGETLGIVGESGSGKS-MTALALMNLLPPAA 64 Query: 65 LVDGKIFLRVNGEFVELSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHLAE 124 ++ + +L+ T E+ K G+ I +I Q M +L P + + ++ Sbjct: 65 KRQASC---IDFDGSDLTHATERELASKIRGQRIGMIFQEPMTSLNPVYSIGRQLKETMT 121 Query: 125 SHG-IDEEELLDKARRRFEEVGL-DPLW-IKRYPFELSGGMRQRAVIAIATILNPSLLIA 181 H + + E ++A E+VGL DP +K+YP ELSGG RQR +IA+A + P LLIA Sbjct: 122 LHRKVSDTEAENRAVYLLEKVGLPDPASRLKQYPHELSGGQRQRVMIAMALMNEPELLIA 181 Query: 182 DEPTSALDVVNQKVLLKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFA 241 DEPT+ALDV Q +L +L ++ +Q S+I ITHD+ V + AD + +MYAG IVE Sbjct: 182 DEPTTALDVTIQAQILHLLREL-QQEFGMSMILITHDLGVVSRAADNIAVMYAGDIVETG 240 Query: 242 PVESLLEKPLHPYTQGLFNSVLTPEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCPHAM 301 +LE P HPYT+GL V + + ++R + IPG P + SGC F RCP A Sbjct: 241 KTGEVLENPRHPYTKGLLECVPGYKGQSQQR-LGAIPGIVPAMTGDISGCAFASRCPRAA 299 Query: 302 DVCKEKEPPLTEIEPGRRVAC 322 VC+ PP ++ GR C Sbjct: 300 GVCRTTNPPTKKLHQGRYFVC 320 Score = 178 bits (452), Expect = 3e-49 Identities = 119/306 (38%), Positives = 170/306 (55%), Gaps = 23/306 (7%) Query: 22 VKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLTLVDGKIFLRVNGEFVE- 80 ++A+D +S + + EV+ +VGESGCGKTTL+ I M + P T G + L NG+ +E Sbjct: 375 LQALDDVSLTLKKGEVLALVGESGCGKTTLTRTI-MGLQAPST---GSVTL--NGQRIEN 428 Query: 81 LSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHLAESHGI-DEEELLDKARR 139 L M R + I I Q ++L P + + + HGI +E + R+ Sbjct: 429 LPPMDR--------ARMIQPIFQDPYSSLNPRKTIGEIIAKPLFVHGIGSNQEQHQQVRK 480 Query: 140 RFEEVGLDPLWIKRYPFELSGGMRQRAVIAIATILNPSLLIADEPTSALDVVNQKVLLKV 199 E VGL YP +LSGG RQRA I A ILNP ++I DEPTSALDV Q +L + Sbjct: 481 MMELVGLPSRVFNSYPDQLSGGQRQRAAIGRALILNPEVVICDEPTSALDVSVQAQILNL 540 Query: 200 LMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFAPVESLLEKPLHPYTQGLF 259 L+ + R + + +F+TH+++ V+ +ADR+ +MY G+IVE + ++ P HPYT L Sbjct: 541 LLDL-RDELDLTYLFVTHNLSVVQHMADRVAVMYLGEIVECGERDQVMSDPKHPYTHALM 599 Query: 260 NSVL--TPEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCPHAMDVCKEKEPPLTEIEPG 317 NS L +P V G++ G PN +N PSGC FHPRCP A C+E+ P E+ Sbjct: 600 NSALSISPGESVPDPGLS---GDFPNPMNRPSGCPFHPRCPLADQQCREQAPG-PELIDN 655 Query: 318 RRVACW 323 V CW Sbjct: 656 TLVQCW 661 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 577 Number of extensions: 29 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 330 Length of database: 672 Length adjustment: 33 Effective length of query: 297 Effective length of database: 639 Effective search space: 189783 Effective search space used: 189783 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory