Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate GFF2860 HP15_2804 oligopeptide/dipeptide ABC transporter, ATP-binding protein-like protein
Query= TCDB::Q97VF5 (362 letters) >FitnessBrowser__Marino:GFF2860 Length = 672 Score = 189 bits (481), Expect = 1e-52 Identities = 112/317 (35%), Positives = 183/317 (57%), Gaps = 7/317 (2%) Query: 45 ILEVHNLNVIYDEGNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPG 104 IL++ +L+V +S + AV +S + +GE LGI+GESGSGK+ A++ + P Sbjct: 6 ILDIQDLSVDIPTDSSTL-HAVRGISLELNRGETLGIVGESGSGKSMTALALMNLLPPAA 64 Query: 105 KIISGKVIFNGMDIFSMTIDEFR-KLLWKDISYVPQASQNALNPVLPISEIFYHEAISHG 163 K + + F+G D+ T E K+ + I + Q +LNPV I H Sbjct: 65 KRQASCIDFDGSDLTHATERELASKIRGQRIGMIFQEPMTSLNPVYSIGRQLKETMTLHR 124 Query: 164 EADKKRVIERASELLKLVGL-DPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEP 222 + RA LL+ VGL DPA LK YP +LSGG +QRVMIA++L+ P+L++ DEP Sbjct: 125 KVSDTEAENRAVYLLEKVGLPDPASRLKQYPHELSGGQRQRVMIAMALMNEPELLIADEP 184 Query: 223 TSALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEE 282 T+ALD+ Q +L L++ + QE G++++ +THD+ +++ A+ + VMY G ++E GKT E Sbjct: 185 TTALDVTIQAQILHLLRELQQEFGMSMILITHDLGVVSRAADNIAVMYAGDIVETGKTGE 244 Query: 283 IIKSPLNPYTSLLVSSIPSLKG--EVKVINVPLDEPLVSKE-KGCPFLARCSKAFGRCKE 339 ++++P +PYT L+ +P KG + ++ +P P ++ + GC F +RC +A G C+ Sbjct: 245 VLENPRHPYTKGLLECVPGYKGQSQQRLGAIPGIVPAMTGDISGCAFASRCPRAAGVCRT 304 Query: 340 ELPEIRLVYD-RKVRCH 355 P + ++ R CH Sbjct: 305 TNPPTKKLHQGRYFVCH 321 Score = 176 bits (447), Expect = 1e-48 Identities = 102/300 (34%), Positives = 173/300 (57%), Gaps = 12/300 (4%) Query: 58 GNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPGKIISGKVIFNGMD 117 G + ++A++DVS ++KGE+L ++GESG GKTTL I+ P +G V NG Sbjct: 370 GKRKPLQALDDVSLTLKKGEVLALVGESGCGKTTLTRTIMGLQAPS----TGSVTLNGQR 425 Query: 118 IFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGEADKKRVIERASEL 177 I ++ + ++ I + Q ++LNP I EI HG + ++ ++ Sbjct: 426 IENLPPMDRARM----IQPIFQDPYSSLNPRKTIGEIIAKPLFVHGIGSNQEQHQQVRKM 481 Query: 178 LKLVGLDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTSALDMLNQELLLKL 237 ++LVGL P+RV YP QLSGG +QR I +L+LNP++++ DEPTSALD+ Q +L L Sbjct: 482 MELVGL-PSRVFNSYPDQLSGGQRQRAAIGRALILNPEVVICDEPTSALDVSVQAQILNL 540 Query: 238 IKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEIIKSPLNPYTSLLVS 297 + ++ E+ +T ++VTH++ + +A+R+ VMY G ++E G+ ++++ P +PYT L++ Sbjct: 541 LLDLRDELDLTYLFVTHNLSVVQHMADRVAVMYLGEIVECGERDQVMSDPKHPYTHALMN 600 Query: 298 SIPSLKGEVKVINVPLDEPL---VSKEKGCPFLARCSKAFGRCKEELPEIRLVYDRKVRC 354 S S+ V + L +++ GCPF RC A +C+E+ P L+ + V+C Sbjct: 601 SALSISPGESVPDPGLSGDFPNPMNRPSGCPFHPRCPLADQQCREQAPGPELIDNTLVQC 660 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 22 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 362 Length of database: 672 Length adjustment: 34 Effective length of query: 328 Effective length of database: 638 Effective search space: 209264 Effective search space used: 209264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory