Align Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate GFF3014 HP15_2958 extracellular solute-binding protein family 1
Query= uniprot:A0A165KPY4 (416 letters) >FitnessBrowser__Marino:GFF3014 Length = 416 Score = 452 bits (1162), Expect = e-131 Identities = 224/410 (54%), Positives = 284/410 (69%), Gaps = 6/410 (1%) Query: 3 KMTKIAAVAVGLAAAMSASAGEVEVLHYWTSGGEAKSVAELKKIMQGKGHTWRDFAVAGG 62 K AAV+ L A + AGEVEVLH+WT+GGEA++ LK++M+ +GHTW+DFAVAGG Sbjct: 8 KTLTAAAVSAALLPAQALQAGEVEVLHWWTAGGEARAAVALKEMMEDQGHTWKDFAVAGG 67 Query: 63 GGDSAMTVLKSRVISGNPPSAAQTKGPAIQEWASEGVLANMDTLAKAEKWDELLPKVVAD 122 GG++AMTVLK+R +SGNPP+AAQ KG I+EWA G L ++D +A+A W +L+P V+AD Sbjct: 68 GGEAAMTVLKTRAVSGNPPAAAQIKGLDIREWAKLGFLTSLDDVAEANNWGQLIPPVIAD 127 Query: 123 VMKYKGAYVAAPVNVHRVNWMWGSSEALKKAGVAAMPKTWDEFFAAADKLKAAGLVPVAH 182 VM+Y+ +YVA PVNVHRVNW+W + E L K GV +PKT DEF+ AA+KLKAAG+ P+AH Sbjct: 128 VMQYEDSYVAVPVNVHRVNWLWANPETLNKVGVG-VPKTLDEFYQAAEKLKAAGITPLAH 186 Query: 183 GGQNWQDFTTFESVVLGVGGAKFYQDALVKLDNTALTSDTMKKSLETFRRIKGYTDPGAP 242 GGQ WQD T FE+V L V G + A V+ D + S M++ F ++ Y D A Sbjct: 187 GGQPWQDATVFEAVALAVMGPDDFASAFVEHDMDVINSAQMEEVFAEFAKVMSYVDDNAA 246 Query: 243 GRDWNLATAMLIQGKAGFQLMGDWAKGEFLAAGKAPGKDFLCAAAPGSANAFTFNVDSFI 302 GRDWN AT M+I+G+A Q+MGDWAKGEF AAG PG+D++CAAAPG+ FTFNVDSF Sbjct: 247 GRDWNTATGMVIRGEAAMQIMGDWAKGEFTAAGLTPGEDYVCAAAPGTGGQFTFNVDSFA 306 Query: 303 LFKLKDAAAQKAQSDLASSIMSPAFQEVFNLNKGSIPVRAGQPMDKFDDCAKASAKDFVD 362 +F L D KAQ DLA +IM P FQ VFN KGSIPVR FD CA+AS F Sbjct: 307 MFSLSDEDNTKAQKDLARTIMEPEFQAVFNKAKGSIPVRT-----DFDTCAQASMDTFKS 361 Query: 363 TAKSGGLVPSAAHGMAIAPATEGAIKDVVSQFWNDDKVSVADAMKKIAAA 412 +A+ GGLVPS AHG+A +G I DVV+ F N D A A ++AAA Sbjct: 362 SAEDGGLVPSFAHGLATTSYVQGQIFDVVTNFVNSDNKDPARATDQLAAA 411 Lambda K H 0.315 0.128 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 599 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 416 Length adjustment: 31 Effective length of query: 385 Effective length of database: 385 Effective search space: 148225 Effective search space used: 148225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory