Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate GFF3012 HP15_2956 sugar ABC transporter, permease protein
Query= uniprot:A3DE71 (289 letters) >FitnessBrowser__Marino:GFF3012 Length = 289 Score = 120 bits (300), Expect = 5e-32 Identities = 82/278 (29%), Positives = 142/278 (51%), Gaps = 19/278 (6%) Query: 23 IILAILVVLTLGPIVFMVLTSLMDHNAIARGKWIA-PTRFSN--YVEVFQKLPFGI---- 75 ++LA LV L P+ M++TS I G +A PT ++ + + + + G+ Sbjct: 20 LLLAALVYLI--PLFIMLVTSFKTPMDIRTGNLMALPTDWTTIGWTKAWSEACTGVQCEG 77 Query: 76 ---YFRNSLIVCSIVMVVALVIATLAGYSLAKYKFPGSGFFGILILATQLLPGMMFLLPL 132 YF NS + ++++ ++ GY L+K+KF GS F ++L +P + LLP+ Sbjct: 78 ISGYFWNSFKMTVPAVLISTLLGAFNGYVLSKWKFKGSDLFFGMLLFGCFVPFQVVLLPM 137 Query: 133 YLDFVKIKQATGIQLINSIPGLVIVYSAFFVPFSIWIIRGFFASIPGELEEAARIDGCNK 192 K+ L N+ GLV+V+ + V F+ R ++ +IP L +AAR+DG Sbjct: 138 AATLGKLG------LANTTSGLVLVHVIYGVAFTTLFFRNYYVAIPDALIKAARLDGAGF 191 Query: 193 FTAFLRVMLPLAVPGIVATAIYIFLTAWDELIFAWVLLK-DTKVTTIPAGIRGFIAYTTA 251 FT F R++LP++ P + + I+ F W++ +F V D++ T+ + Sbjct: 192 FTIFFRILLPMSTPIFMVSLIWQFTQIWNDFLFGVVFASGDSQPITVALNNLVNTSTGVK 251 Query: 252 RYDLLMAAGTIVTIPVLIMFFTMQKKFISGMTAGAVKG 289 Y++ MAA I +P L+++ K FI G+TAG+VKG Sbjct: 252 EYNVDMAAAMIAALPTLVVYIVAGKYFIRGLTAGSVKG 289 Score = 24.3 bits (51), Expect = 0.003 Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 244 GFIAYTTARYDLLMAAGTIVTIPVLIMFFTMQK 276 GF A Y LL+ A + IP+ IM T K Sbjct: 8 GFRPSRVAIYGLLLLAALVYLIPLFIMLVTSFK 40 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 289 Length of database: 289 Length adjustment: 26 Effective length of query: 263 Effective length of database: 263 Effective search space: 69169 Effective search space used: 69169 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory