GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acn in Marinobacter adhaerens HP15

Align 2-methylcitrate dehydratase (EC 4.2.1.79) (characterized)
to candidate GFF1971 HP15_1928 2-methylcitrate dehydratase PrpD

Query= BRENDA::P77243
         (483 letters)



>lcl|FitnessBrowser__Marino:GFF1971 HP15_1928 2-methylcitrate
           dehydratase PrpD
          Length = 494

 Score =  577 bits (1488), Expect = e-169
 Identities = 291/497 (58%), Positives = 368/497 (74%), Gaps = 17/497 (3%)

Query: 1   MSAQIN-NIRPEFDREIVDIVDYVMNYEISSKVAYDTAHYCLLDTLGCGLEALEYPACKK 59
           MSA  + N RP++D  +  I DYV+ YEI+S+ A++TA YCL+DTLGC L AL +P C K
Sbjct: 1   MSATFDLNERPDYDEVLQKIADYVLTYEITSEEAWNTARYCLMDTLGCALLALRFPECTK 60

Query: 60  LLGPIVPGTVVPNGVRVPGTQFQLDPVQAAFNIGAMIRWLDFNDTWLAAEWGHPSDNLGG 119
            LGPIV GT+VP+G RVPGT ++LDPV+AA++IG  +RWLD+NDTWLAAEWGHPSDNLG 
Sbjct: 61  HLGPIVEGTMVPHGARVPGTPYRLDPVKAAWDIGCNVRWLDYNDTWLAAEWGHPSDNLGA 120

Query: 120 ILATADWLSRNAVASGKAPLTMKQVLTAMIKAHEIQGCIALENSFNRVGLDHVLLVKVAS 179
           ILA AD LS+  VA GK PLTM+ VL AMI AHEIQG +ALENSFNRVGLDHV+LVKVAS
Sbjct: 121 ILAVADHLSQKRVAEGKEPLTMRTVLEAMIMAHEIQGVLALENSFNRVGLDHVVLVKVAS 180

Query: 180 TAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKSWAAGDATSRAVRLALMA 239
           TAV + ++G  RE++L+A+S AWVDGQSLRTYRHAPN G+RKSWAAGDATSRAVRLA +A
Sbjct: 181 TAVASRLMGADREQLLSALSHAWVDGQSLRTYRHAPNAGSRKSWAAGDATSRAVRLADIA 240

Query: 240 KTGEMGYPSALTAPVWGFYDVSFK------------GESFRFQRPYGSYVMENVLFKISF 287
             GEMG P  LTAP WGFYDV F                F   + +GSYVMEN+LFKISF
Sbjct: 241 MRGEMGVPGVLTAPQWGFYDVLFSKTNKDQKLKPEDKRQFSLPQEFGSYVMENILFKISF 300

Query: 288 PAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVTIRTHEACIRIIDKKGPLNNPADRDHC 347
           PAEFH+QTA EAA+ LY +++       +I K+ I THE+ IRII K G L N ADRDHC
Sbjct: 301 PAEFHAQTAAEAAVILYPEVK---DRLNEINKIVITTHESAIRIISKVGKLANAADRDHC 357

Query: 348 IQYMVAIPLLFGRLTAADYEDNVAQ-DKRIDALREKINCFEDPAFTADYHDPEKRAIANA 406
           +QYM A+PL FG LTA  YED+  + +  ID LR+K+   ED  +T +Y +PEKR+IANA
Sbjct: 358 LQYMAAVPLAFGSLTAEHYEDSFHRANPIIDELRDKMEVVEDERYTREYLEPEKRSIANA 417

Query: 407 ITLEFTDGTRFEEVVVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQRILEVSLDR 466
           I + F DG+  +++ VEYPIGH RRR++G+P L +KF  NL  + P+++   +L++  D 
Sbjct: 418 IQVFFNDGSNTDKIAVEYPIGHRRRRKEGMPLLEEKFLSNLKTRLPSKRCDTVLKMCQDP 477

Query: 467 ARLEQMPVNEYLDLYVI 483
            +LE  PV+E+++L +I
Sbjct: 478 EKLENTPVHEFMNLLLI 494


Lambda     K      H
   0.321    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 674
Number of extensions: 21
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 483
Length of database: 494
Length adjustment: 34
Effective length of query: 449
Effective length of database: 460
Effective search space:   206540
Effective search space used:   206540
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory