Align Citrate:H+ symporter (characterized)
to candidate GFF1381 HP15_1348 major facilitator family transporter
Query= TCDB::P16482 (444 letters) >FitnessBrowser__Marino:GFF1381 Length = 414 Score = 222 bits (565), Expect = 2e-62 Identities = 132/414 (31%), Positives = 222/414 (53%), Gaps = 13/414 (3%) Query: 36 GNFLEQFDFFLFGFYATYIAHTFFPASSEFASLMMTFAVFGAGFLMRPIGAIVLGAYIDK 95 GN +E +DF ++G+ A IA FF +++ A+L+ T+ +F AGF+MRP+GA V G + D+ Sbjct: 6 GNVVEWYDFAVYGYLAGVIAPVFFSSANPTAALIGTYGIFAAGFIMRPLGAAVFGWFGDR 65 Query: 96 VGRRKGLIVTLSIMATGTFLIVLIPSYQTIGLWAPLLVLIGRLLQGFSAGAELGGVSVYL 155 GR + + +++ +MA T L+ ++PSYQ GL AP+L+++ RLLQG S G E + YL Sbjct: 66 YGRARTMQISVMLMALPTLLLGMLPSYQQAGLLAPVLLVLIRLLQGLSVGGEFSSSATYL 125 Query: 156 AEIATPGRKGFYTSWQSGSQQVAIMVAAAMGFALNAVLEPSAISDWGWRIPFLFGVLIVP 215 E A G++G SW + ++ A + L+ +SDWGWR+PFL G ++ Sbjct: 126 VETAPDGKRGLTGSWANIGSMTGSLLGVAAAALVTNTLDEQTLSDWGWRLPFLGGAILGI 185 Query: 216 FIFILRRKLEETQEFTARRHH------LAMRQVFATLLANWQVVIAGMMMVAMTTTAFYL 269 +RR L ++ F+ +HH + Q F T N + + + + T +Y+ Sbjct: 186 AAIAIRRNLHNSERFS--QHHENRDETSPLLQAFTT---NRRETLLALAFASSYGTCYYI 240 Query: 270 ITVYAPTFGKKVLMLSASDSLLVTLLVAISNFFWLPVGGALSDRFGRRSVLIAMTLLAL- 328 + VY P + +LS +LL+ + + +P+ + DR+ RR IA++L L Sbjct: 241 VFVYLPEWLSAQELLSRGTALLINTGMMLLVIPAMPLFAIVGDRWLRRRSWIAISLFLLT 300 Query: 329 ATAWPALTMLANAPSFLMMLSVLLWLSFIYGMYNGAMIPAL-TEIMPAEVRVAGFSLAYS 387 AWP + ++ L ++ + L F+ PAL E+ P R++G+S+A++ Sbjct: 301 VVAWPLHAWMLSSGGSLYVVVLAHALVFLLLAIPLGSAPALFVEMFPESDRLSGYSVAFN 360 Query: 388 LATAVFGGFTPVISTALIEYTGDKASPGYWMSFAAICGLLATCYLYRRSAVALQ 441 L VFGG TP+I+T+LI TG +P +++ A +LA + RS L+ Sbjct: 361 LGLGVFGGLTPMIATSLIATTGVVTAPAMYLAVTAFIAVLALIAMPDRSREPLR 414 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 414 Length adjustment: 32 Effective length of query: 412 Effective length of database: 382 Effective search space: 157384 Effective search space used: 157384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory