Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate GFF3640 HP15_3582 transport system permease protein
Query= CharProtDB::CH_004160 (318 letters) >FitnessBrowser__Marino:GFF3640 Length = 326 Score = 185 bits (470), Expect = 1e-51 Identities = 117/280 (41%), Positives = 167/280 (59%), Gaps = 11/280 (3%) Query: 46 VLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPS 105 V+ RLPR+ AL VGAALA AG Q + RNPL SPDILGV+ A L +V + L S Sbjct: 47 VVWNIRLPRVAAALLVGAALAAAGASYQALFRNPLVSPDILGVSAGAGLGAVAGIFL--S 104 Query: 106 LPVMVLPLLAFAGGM--AGLILL--KMLAKTHQPMKLALTGVALSACWASLTDYL-MLSR 160 LPV + AF GGM G ++L ++ T + + L L GV + A + T L +++ Sbjct: 105 LPVAAIQASAFVGGMLAVGFVILVASLVRNTDRTLTLVLIGVVIGALAGAATSLLKVMAD 164 Query: 161 PQDVNNAL-LWLTGSLWGRDWSFVKIAIPLMILFL-PLSLSFCRDLDLLALGDARATTLG 218 P D A+ WL GSL + +P++++ L PL+L R +++L+LGD A LG Sbjct: 165 PYDQLPAITFWLLGSLAATTTEDILPTLPMVLIGLVPLALLRWR-INVLSLGDEEARALG 223 Query: 219 VSVPHTRFWALLLAVAMTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGAL 278 + V TRF ++ A +T++ A G + ++GLV+PH+ R + G RLLP S L GA Sbjct: 224 IDVSKTRFLVIVAATLITASVTALAGVVGWVGLVIPHIARMLVGPGFGRLLPTSVLIGAG 283 Query: 279 LLVVADLLARIIHPPLELPVGVLTAIIGAPWFVWLLVRMR 318 L+V D LAR + +E+P+G+LTA+IGAP+FVWLL R R Sbjct: 284 YLLVVDTLARTM-AQVEVPLGILTAVIGAPFFVWLLARGR 322 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 326 Length adjustment: 28 Effective length of query: 290 Effective length of database: 298 Effective search space: 86420 Effective search space used: 86420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory