Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate GFF2976 HP15_2920 amino acid ABC transporter, ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >FitnessBrowser__Marino:GFF2976 Length = 248 Score = 251 bits (641), Expect = 1e-71 Identities = 125/247 (50%), Positives = 176/247 (71%), Gaps = 8/247 (3%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 ++++ ++K +G VLK + L G+V+ IIG+SGSGKST +RC+N LE+ +G + ++ Sbjct: 5 VKMKGMNKYFGKLHVLKDIDLTVEQGEVVVIIGASGSGKSTLIRCVNGLEEYESGTLEVD 64 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 ++L A K+ +PK L +R + MVFQ FNL+ H+T NIM AP V + Sbjct: 65 GQQL--------APKSGNPKALAEIRKEVGMVFQQFNLFPHLTVKRNIMLAPKKVKETPE 116 Query: 124 TEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 T A AE LN+VG+ ++ D YP +SGG+QQRVAIARALAMEP +MLFDEPTSALDPE Sbjct: 117 TVANATAERLLNRVGIGNQADKYPSQLSGGQQQRVAIARALAMEPRLMLFDEPTSALDPE 176 Query: 184 LVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSE 243 ++G+VL VM+ LA+EG TM+VVTHEMGFAREV+++++++H+G + E G P +V NPQ+E Sbjct: 177 MIGEVLDVMRELAKEGMTMMVVTHEMGFAREVADRVIYIHEGAIVEQGKPDDVFDNPQNE 236 Query: 244 RLQQFLS 250 R Q FLS Sbjct: 237 RTQAFLS 243 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 248 Length adjustment: 24 Effective length of query: 230 Effective length of database: 224 Effective search space: 51520 Effective search space used: 51520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory