Align Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 (characterized)
to candidate GFF771 HP15_750 ornithine carbamoyltransferase
Query= SwissProt::P11724 (305 letters) >lcl|FitnessBrowser__Marino:GFF771 HP15_750 ornithine carbamoyltransferase Length = 304 Score = 389 bits (999), Expect = e-113 Identities = 193/299 (64%), Positives = 229/299 (76%) Query: 1 MSVRHFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSF 60 M+ RHFL+ D + EL L+ + L++ +G + + LK+RVL M+FEK+STRTR+SF Sbjct: 1 MAARHFLTLNDMTTNELESLVDHATALRNEWRQGKVRDSLKNRVLAMIFEKSSTRTRVSF 60 Query: 61 EAGMIQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHATLTEFAAHSKV 120 EAGM QLGG A+FLSPRDTQLGRGEPI DSA V+S M+D VMIRTFAH T+ FAA S+V Sbjct: 61 EAGMTQLGGSAMFLSPRDTQLGRGEPIEDSAIVISSMVDAVMIRTFAHETVERFAAASRV 120 Query: 121 PVINGLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEAALKFDFQLRV 180 PVIN L+DD HPCQLLADMQTF EHRGSI+G TVAWIGDGNNMC+SYI AA +FDF L + Sbjct: 121 PVINALTDDFHPCQLLADMQTFREHRGSIRGATVAWIGDGNNMCHSYINAAAQFDFNLNI 180 Query: 181 ACPEGYEPKAEFVALAGDRLRVVRDPREAVAGAHLVSTDVWASMGQEDEAAARIALFRPY 240 ACPEGYEP + DR++V R+P EA A L+ TDVWASMGQEDE AR F Y Sbjct: 181 ACPEGYEPAESMLKGHEDRVKVFREPAEAARNAQLLVTDVWASMGQEDEQKARERAFSGY 240 Query: 241 QVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALLELLI 299 Q+N LL A DVLFMHCLPAHRGEEIS ++++ P SV W++AENRLHAQKALLE LI Sbjct: 241 QINPGLLSVADKDVLFMHCLPAHRGEEISADMMEHPASVVWNEAENRLHAQKALLEFLI 299 Lambda K H 0.322 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 304 Length adjustment: 27 Effective length of query: 278 Effective length of database: 277 Effective search space: 77006 Effective search space used: 77006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate GFF771 HP15_750 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00658.hmm # target sequence database: /tmp/gapView.5501.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-119 382.8 0.0 6.5e-119 382.6 0.0 1.0 1 lcl|FitnessBrowser__Marino:GFF771 HP15_750 ornithine carbamoyltran Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF771 HP15_750 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 382.6 0.0 6.5e-119 6.5e-119 1 303 [. 4 299 .. 4 300 .. 0.98 Alignments for each domain: == domain 1 score: 382.6 bits; conditional E-value: 6.5e-119 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvlylnkeel 76 rh+l+l d++++el++l++ a+ l++e ++gk ++ lk++ la+iFek+stRtRvsfe+++++lG+ +++l++ ++ lcl|FitnessBrowser__Marino:GFF771 4 RHFLTLNDMTTNELESLVDHATALRNEWRQGKVRDSLKNRVLAMIFEKSSTRTRVSFEAGMTQLGGSAMFLSPRDT 79 8*************************************************************************** PP TIGR00658 77 qlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltikeklgklkevklv 152 qlgr+e+i+D a v+s++vda+++R+++he+ve +a + vPvin+Ltd +hPcq+laD++t +e+ g++ + +++ lcl|FitnessBrowser__Marino:GFF771 80 QLGRGEPIEDSAIVISSMVDAVMIRTFAHETVERFAAASRVPVINALTDDFHPCQLLADMQTFREHRGSIRGATVA 155 **************************************************************************** PP TIGR00658 153 yvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedpkkavkdadviytDvwvsm 228 ++GD+nn+++s + aaa++ +++++a+Peg+ep ++++k + ++++ ++p++a+++a++++tDvw+sm lcl|FitnessBrowser__Marino:GFF771 156 WIGDGNNMCHSYINAAAQFDFNLNIACPEGYEPAESMLKGH-------EDRVKVFREPAEAARNAQLLVTDVWASM 224 *********************************88777655.......569************************* PP TIGR00658 229 GeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdevlegeasivfdeaenRlhaqkavlkall 303 G+e+++++r +++ +yq+n ll++a+++v f+hCLPa+rGee++ +++e +as+v++eaenRlhaqka+l++l+ lcl|FitnessBrowser__Marino:GFF771 225 GQEDEQKARERAFSGYQINPGLLSVADKDVLFMHCLPAHRGEEISADMMEHPASVVWNEAENRLHAQKALLEFLI 299 ***********************************************************************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (304 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.78 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory