Align succinylglutamate desuccinylase (EC 3.5.1.96) (characterized)
to candidate GFF3091 HP15_3034 succinylglutamate desuccinylase
Query= BRENDA::O50177 (332 letters) >FitnessBrowser__Marino:GFF3091 Length = 351 Score = 227 bits (579), Expect = 3e-64 Identities = 129/309 (41%), Positives = 178/309 (57%), Gaps = 6/309 (1%) Query: 26 DGTRLHWLAEGALEVTPIGARDN--GVDLLLSAGIHGNETAPIELLERLIRKVAAGTLKP 83 DGTR+ A G L++ P AR N +++SAG+HGNETAPIE+L RL+ ++ G + Sbjct: 35 DGTRISRKAVGVLDIVPPAARSNPNAEAIIVSAGVHGNETAPIEVLNRLVSELIEGEWEL 94 Query: 84 AARVLFLFGNPEAIRRGERYVEQDMNRLFNGRHEEGSGN---EAFRAAELERLAQVFFSK 140 A VL + GNP A+ G+R++E ++NRLF+G H EA RA ELE + F Sbjct: 95 ACPVLLIMGNPPAMVAGKRFLEVNLNRLFDGAHSRNEYEGLAEAARAQELEEACRQFAMA 154 Query: 141 TERVHLHYDLHTAIRGSKIEQFALYPWAEGRQHSRSELARLRDAGIEAVLLQNKPGITFS 200 + HYDLHTAIR S E+FALYP+ EGR + L +A +E +LLQ+K G TFS Sbjct: 155 NPQALYHYDLHTAIRPSHRERFALYPFVEGRTVPVDQCDFLLEAEVETLLLQHKAGTTFS 214 Query: 201 AYTYGQLGAEAFTLELGKARPFGENQEVNLERLERSLELLIDGSEEQPDGSRLDGLKLFS 260 +++ L AE+FT+ELGK RPFG+N + +L G D L +F Sbjct: 215 SFSSSLLKAESFTVELGKVRPFGQNDLGRFSGIRDALRRRFKGQPSPAPQPPFDHLTVFE 274 Query: 261 VSREVIKHSDHFRLHLDDDVANFTELSPGYLLAEDIGGTRWVVDEVGARIIFPNPRVKNG 320 V E++ +FR H+ DDVANFTE PG ++ ED T + V I+FPNP V G Sbjct: 275 VVHEILNTGKNFRFHIPDDVANFTEYQPGTVIWED-DETSYRVGHSPEAIVFPNPEVPVG 333 Query: 321 LRAGILVVP 329 R G+++ P Sbjct: 334 HRVGLMIRP 342 Lambda K H 0.319 0.138 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 351 Length adjustment: 29 Effective length of query: 303 Effective length of database: 322 Effective search space: 97566 Effective search space used: 97566 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF3091 HP15_3034 (succinylglutamate desuccinylase)
to HMM TIGR03242 (astE: succinylglutamate desuccinylase (EC 3.5.1.96))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03242.hmm # target sequence database: /tmp/gapView.28566.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03242 [M=319] Accession: TIGR03242 Description: arg_catab_astE: succinylglutamate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-98 313.8 0.0 7.7e-98 313.7 0.0 1.0 1 lcl|FitnessBrowser__Marino:GFF3091 HP15_3034 succinylglutamate desu Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF3091 HP15_3034 succinylglutamate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 313.7 0.0 7.7e-98 7.7e-98 19 318 .. 34 340 .. 13 341 .. 0.92 Alignments for each domain: == domain 1 score: 313.7 bits; conditional E-value: 7.7e-98 TIGR03242 19 aknvklrwldeGvlelePe....aeaekslvisaGihGnetaPielleqllsdiaagklqlkvrlLlilGnpaal 89 + ++ + Gvl ++P + +++++saG+hGnetaPie+l++l+s++++g+ +l + +Lli+Gnp+a+ lcl|FitnessBrowser__Marino:GFF3091 34 PDGTRISRKAVGVLDIVPPaarsNPNAEAIIVSAGVHGNETAPIEVLNRLVSELIEGEWELACPVLLIMGNPPAM 108 66777888899******987776777899********************************************** PP TIGR03242 90 rkgkRyleedlnRlfgGryq..eleeskeklRaeeLeqvveaffeagkasearyhyDlhtaiRasklekfallPy 162 +gkR+le +lnRlf G + e+e e+ Ra+eLe++ ++f a ++ yhyDlhtaiR s+ e+fal+P lcl|FitnessBrowser__Marino:GFF3091 109 VAGKRFLEVNLNRLFDGAHSrnEYEGLAEAARAQELEEACRQFAMANPQA--LYHYDLHTAIRPSHRERFALYPF 181 ******************9633688899**************98887777..6*********************9 PP TIGR03242 163 q.ekpfdkellewlaaadldavllhkekggtfshfssekleaeactlelGkarPfGendlsqfqaitealralis 236 ++ + ++l +a+++++ll++++g+tfs fss l+ae++t+elGk+rPfG+ndl +f+ i +alr+ lcl|FitnessBrowser__Marino:GFF3091 182 VeGRTVPVDQCDFLLEAEVETLLLQHKAGTTFSSFSSSLLKAESFTVELGKVRPFGQNDLGRFSGIRDALRRRFK 256 8899999*******************************************************************9 PP TIGR03242 237 deaiparkke..elklfevvesilkksdsfelhvaedasnftefakGtllaedkderyrveeeeerilfPnakva 309 ++ pa + +l fevv++il + +f++h+++d+ nfte++ Gt++ ed ++ yrv ++ e i+fPn++v lcl|FitnessBrowser__Marino:GFF3091 257 GQPSPAPQPPfdHLTVFEVVHEILNTGKNFRFHIPDDVANFTEYQPGTVIWEDDETSYRVGHSPEAIVFPNPEVP 331 988877664444*************************************************************** PP TIGR03242 310 nGlRaglll 318 G R gl++ lcl|FitnessBrowser__Marino:GFF3091 332 VGHRVGLMI 340 ********8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (319 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.29 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory