GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fadB in Marinobacter adhaerens HP15

Align 3-hydroxyadipyl-CoA dehydrogenase; EC 1.1.1.- (characterized)
to candidate GFF2749 HP15_2693 3-hydroxybutyryl-CoA dehydrogenase

Query= SwissProt::P76083
         (475 letters)



>lcl|FitnessBrowser__Marino:GFF2749 HP15_2693 3-hydroxybutyryl-CoA
           dehydrogenase
          Length = 506

 Score =  385 bits (988), Expect = e-111
 Identities = 224/503 (44%), Positives = 306/503 (60%), Gaps = 30/503 (5%)

Query: 3   INVQT-VAVIGSGTMGAGIAEVAASHGHQVLLYDISAEALTRAIDGIHARLNSRVTRGKL 61
           ++ QT VAV+G+G MG+GIA+VAA  GHQV L+D    A     DGI  +L  RV +GK+
Sbjct: 4   LDTQTKVAVVGAGAMGSGIAQVAAQAGHQVYLHDQREGAAEAGRDGIAKQLQRRVDKGKM 63

Query: 62  TAETCERTLKRLIPVTDIHALAAADLVIEAASERLEVKKALFAQLAEVCPPQTLLTTNTS 121
             +  +  + R+ PV  +  +A A LVIEA  E L++K+ L A L ++C    +L TNTS
Sbjct: 64  QQQELDDVIGRIHPVAKLDDVADAGLVIEAIIEDLQIKRQLLASLEDLCTADAILATNTS 123

Query: 122 SISITAIAAEIKNPERVAGLHFFNPAPVMKLVEVVSGLATAAEVVEQLCELTLSWGKQPV 181
           SIS+TA+ A++  PER+ G+HFFNPAP+M LVEVV GLAT+  V + +     +WGK+PV
Sbjct: 124 SISVTALGADMSKPERLVGMHFFNPAPLMALVEVVMGLATSKTVADTVHATATAWGKKPV 183

Query: 182 RCHSTPGFIVNRVARPYYSEAWRALEEQVAAPEVIDAALRDGAGFPMGPLELTDLIGQDV 241
              STPGFIVNRVARP+Y+E+ R L+EQ      +DA +R+   F MG  ELTDLIG DV
Sbjct: 184 YATSTPGFIVNRVARPFYAESLRLLQEQATDAATLDAIIREAGQFRMGAFELTDLIGHDV 243

Query: 242 NFAVTCSVFNAFWQERRFLPSLVQQELVIGGRLGKKSGLGVYDW--RAER---------- 289
           N+AVT SVFN+++Q+ RFLPSL+Q+ELV  GRLG+KSG G Y +   AE+          
Sbjct: 244 NYAVTSSVFNSYYQDPRFLPSLIQKELVEAGRLGRKSGQGFYPYGESAEKPQPKTEPAHQ 303

Query: 290 --EAVVGLEAVSDSFSPMKVEKKSDGVTEID----------DVLLIETQGE--TAQALAI 335
             E+V+  E      +P+    K+ G+T I+          D +L  T G   T +A   
Sbjct: 304 SDESVIIAEGNPGVAAPLLERLKAAGLTIIERDGPGQIRFGDAVLALTDGRMATERAACE 363

Query: 336 RLARPV---VVIDKMAGKVVTIAAAAVNPDSATRKAIYYLQQQGKTVLQIADYPGMLIWR 392
            +A  V   +  D      + +A A    D+A   A   LQ+ G  V  IAD PG++I R
Sbjct: 364 GVANLVLFDLAFDYSKASRLALAPADQASDAAVSCACALLQKAGIEVSLIADRPGLVIMR 423

Query: 393 TVAMIINEALDALQKGVASEQDIDTAMRLGVNYPYGPLAWGAQLGWQRILRLLENLQHHY 452
           TVAM+ NEA DA   GVA+  DID AM+ G+NYP GPL+W  +LG   + ++L N+Q  Y
Sbjct: 424 TVAMLANEAADAALHGVATVADIDLAMKAGLNYPDGPLSWSDRLGAGHVFKVLTNIQTSY 483

Query: 453 GEERYRPCSLLRQRALLESGYES 475
            E+RYRP  LLR+ A  + G+ S
Sbjct: 484 AEDRYRPALLLRKNAFAQKGFYS 506


Lambda     K      H
   0.319    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 550
Number of extensions: 17
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 475
Length of database: 506
Length adjustment: 34
Effective length of query: 441
Effective length of database: 472
Effective search space:   208152
Effective search space used:   208152
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory