Align 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 (characterized)
to candidate GFF3766 HP15_3708 4-aminobutyrate aminotransferase
Query= SwissProt::P22256 (426 letters) >lcl|FitnessBrowser__Marino:GFF3766 HP15_3708 4-aminobutyrate aminotransferase Length = 425 Score = 422 bits (1084), Expect = e-122 Identities = 210/421 (49%), Positives = 277/421 (65%) Query: 3 SNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKV 62 SNKEL + + + G + FAD A N +WD +G+ +DFAGGI VLN GH HPKV Sbjct: 2 SNKELQALKERYVAAGAASPNEQFADHATNAELWDADGKRMIDFAGGIGVLNIGHRHPKV 61 Query: 63 VAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIA 122 V AV+AQL KL HTC V+ YE Y++L E ++ VP K +L +G+EA+ENA+KIA Sbjct: 62 VEAVKAQLDKLMHTCQTVMPYEGYVKLAEKLSGVVPVRGHAKVMLANSGAEALENAMKIA 121 Query: 123 RAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISEDD 182 RAAT ++ I F G YHGRT YT+A+ GK PY G MPG VYRA YP P HG+SED+ Sbjct: 122 RAATGKTNVICFDGGYHGRTFYTMAMNGKAAPYQTDFGPMPGTVYRAPYPVPYHGVSEDE 181 Query: 183 AIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQ 242 A+ + K D+ + AAIVIEPV GEGGFYA+ +F++ +R +CDE+ I++IADEVQ Sbjct: 182 ALRGLKMAMKADSPAHNTAAIVIEPVLGEGGFYAAPTSFLKEIRKICDENDILMIADEVQ 241 Query: 243 SGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAGNP 302 SG GRTG +FA+E GV PDL T AKS+A G P++ + G + MDA P LGGTY G+P Sbjct: 242 SGFGRTGKMFAIEHSGVEPDLMTMAKSMADGMPISAIVGTDKYMDASGPNSLGGTYTGSP 301 Query: 303 IACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFED 362 AC AAL V VF++E++L K+ LG+KLK E+ + +VR LG M A EL E Sbjct: 302 TACAAALAVFDVFKEEDILGKSQALGEKLKQRFSQWQEQFAHVDNVRNLGPMAAFELVES 361 Query: 363 GDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQCFD 422 + P +L A + +A++KGLILLSCG Y N LR L+P+TIED + +GL I+ + Sbjct: 362 KESRTPKPELAAAVTKKAKEKGLILLSCGMYGNTLRFLMPVTIEDEVLEEGLAIVEESLK 421 Query: 423 E 423 E Sbjct: 422 E 422 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 425 Length adjustment: 32 Effective length of query: 394 Effective length of database: 393 Effective search space: 154842 Effective search space used: 154842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate GFF3766 HP15_3708 (4-aminobutyrate aminotransferase)
to HMM TIGR00700 (gabT: 4-aminobutyrate transaminase (EC 2.6.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00700.hmm # target sequence database: /tmp/gapView.13186.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00700 [M=420] Accession: TIGR00700 Description: GABAtrnsam: 4-aminobutyrate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-161 522.0 0.6 5.6e-161 521.7 0.6 1.0 1 lcl|FitnessBrowser__Marino:GFF3766 HP15_3708 4-aminobutyrate aminot Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF3766 HP15_3708 4-aminobutyrate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 521.7 0.6 5.6e-161 5.6e-161 5 419 .. 12 421 .. 9 422 .. 0.97 Alignments for each domain: == domain 1 score: 521.7 bits; conditional E-value: 5.6e-161 TIGR00700 5 aavskGvgvtlrvlaakaegaelkdvdGnrlidlaagiavlnvGhshPkvveavkrqveelthtafqvvpyesyv 79 +v+ G + ++ +a +a +ael d dG+r+id+a+gi+vln+Gh+hPkvveavk q+++l+ht+ +v+pye+yv lcl|FitnessBrowser__Marino:GFF3766 12 RYVAAGAASPNEQFADHATNAELWDADGKRMIDFAGGIGVLNIGHRHPKVVEAVKAQLDKLMHTCQTVMPYEGYV 86 678999999****************************************************************** PP TIGR00700 80 elaeklnaiaPgsgekkavllnsGaeavenavkiarkytgrpgvvafsrgfhGrtnltmaltakvkPykiGfGPf 154 +laekl+++ P+ g++k +l nsGaea+ena+kiar+ tg+ v++f++g+hGrt+ tma+ +k++Py++ fGP+ lcl|FitnessBrowser__Marino:GFF3766 87 KLAEKLSGVVPVRGHAKVMLANSGAEALENAMKIARAATGKTNVICFDGGYHGRTFYTMAMNGKAAPYQTDFGPM 161 *************************************************************************** PP TIGR00700 155 apevyraPlpydyrdialdkqeslddelaaiealfvadveaeqvaavvlePvqGeGGfivpakelvaavaslcke 229 ++ vyraP+p +y++ + +e+ l+ ++ ++ad a++ aa+v+ePv GeGGf ++ ++++++++c+e lcl|FitnessBrowser__Marino:GFF3766 162 PGTVYRAPYPVPYHGVSE--DEA----LRGLKMAMKADSPAHNTAAIVIEPVLGEGGFYAAPTSFLKEIRKICDE 230 ***************988..555....5588888999************************************** PP TIGR00700 230 hgivliadevqtGfartGklfaieheddkPdlitvaksladGlPlsgvvGraeildapapGglGGtyaGnPlava 304 ++i++iadevq+Gf rtGk+faieh +++Pdl+t+aks+adG+P+s++vG + +da+ p lGGty+G+P a+a lcl|FitnessBrowser__Marino:GFF3766 231 NDILMIADEVQSGFGRTGKMFAIEHSGVEPDLMTMAKSMADGMPISAIVGTDKYMDASGPNSLGGTYTGSPTACA 305 *************************************************************************** PP TIGR00700 305 aalavldiieeeglieraeqigklvkdklielkeevpaigdvrglGamiavelv.dpdttePdaalaekiaaaal 378 aalav+d+ +ee + +++ +g+ +k++ +++e++ + +vr+lG m+a elv +++ P+ la++++++a+ lcl|FitnessBrowser__Marino:GFF3766 306 AALAVFDVFKEEDILGKSQALGEKLKQRFSQWQEQFAHVDNVRNLGPMAAFELVeSKESRTPKPELAAAVTKKAK 380 ******************************************************5557899************** PP TIGR00700 379 aaGlllltaGifGniirlltPltisdelldeglkileaala 419 ++Gl+ll++G++Gn +r+l+P+ti de l+egl i+e++l+ lcl|FitnessBrowser__Marino:GFF3766 381 EKGLILLSCGMYGNTLRFLMPVTIEDEVLEEGLAIVEESLK 421 *************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (425 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.26 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory