Align L-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.2 (characterized)
to candidate GFF2544 HP15_2488 FAD dependent oxidoreductase
Query= SwissProt::Q9LES4 (483 letters) >FitnessBrowser__Marino:GFF2544 Length = 369 Score = 308 bits (788), Expect = 3e-88 Identities = 180/396 (45%), Positives = 228/396 (57%), Gaps = 41/396 (10%) Query: 82 TVVIGAGVVGLAVARELSLRGREVLILDAASSFGTVTSSRNSEVVHAGIYYPPNSLKAKF 141 TVVIGAGV+GLA+AR L+ G EV++L+++ FG SSRNSEVVHAGIYYP SLKA+ Sbjct: 10 TVVIGAGVIGLAIARALARAGHEVIVLESSDRFGEGISSRNSEVVHAGIYYPQGSLKAEL 69 Query: 142 CVRGRELLYKYCSEYEIPHKKIGKLIVATGSSEIPKLDLLMHLGTQNRVSGLRMLEGFEA 201 CV GR+ LY YC +++ H+K GK IVA ++ KL + N V L +G Sbjct: 70 CVEGRQQLYDYCLTHKVGHRKCGKWIVAVDEAQNDKLCDIKAAAASNGVE-LEFYDGERV 128 Query: 202 MRMEPQLRCVKALLSPESGILDTHSFMLSLVEKSFDFMVYRDNNNLRLQGEAQNNHATFS 261 + P + L SPE+GI+D+H MLSL+ GE + + Sbjct: 129 AQGVPGICASSGLWSPETGIVDSHGLMLSLL------------------GELHDAGGQLA 170 Query: 262 YNTVVLNGRVEEKKMHLYVADTRFSESRCEAEAQLELIPNLVVNSAGLGAQALAKRLHGL 321 + V + ++ L VA E L L V+N+AGLGA LAK GL Sbjct: 171 LRSPVAAAESDSQRHRLNVA----------GETPLILEAKNVINAAGLGAVPLAKNWAGL 220 Query: 322 DHRFVPSSHYARGCYFTLSGIKAPPFNKLVYPIPEEGGLGVHVTVDLNGLVKFGPDVEWI 381 +P +ARG YF+ SG PF L+YP+PE GGLG+H+T+DL G +FGPDVEWI Sbjct: 221 PDDCIPRQWFARGVYFSYSG--RTPFRTLIYPVPEPGGLGIHLTLDLAGQARFGPDVEWI 278 Query: 382 ECTDDTSSFLNKFDYRVNPQRSEKFYPEIRKYYPDLKDGSLEPGYSGIRPKLSGPKQSPA 441 E K DY V P R E F IR+++P L L+P Y+GIRPKL GP A Sbjct: 279 E----------KEDYTVEPSRQEGFARGIRQWWPGLDPTRLQPAYAGIRPKLIGPDGGFA 328 Query: 442 DFVIQGEETHGVPGLVNLFGIESPGLTSSLAIAEHI 477 DF I G ETHG+PGLVNLFGIESPGLTS LAIAE + Sbjct: 329 DFRIDGPETHGLPGLVNLFGIESPGLTSCLAIAERV 364 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 473 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 369 Length adjustment: 32 Effective length of query: 451 Effective length of database: 337 Effective search space: 151987 Effective search space used: 151987 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory