GapMind for catabolism of small carbon sources

 

Alignments for a candidate for acs in Marinobacter adhaerens HP15

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate GFF832 HP15_811 acetyl-CoA synthetase

Query= SwissProt::Q8ZKF6
         (652 letters)



>FitnessBrowser__Marino:GFF832
          Length = 649

 Score =  968 bits (2502), Expect = 0.0
 Identities = 455/643 (70%), Positives = 535/643 (83%), Gaps = 1/643 (0%)

Query: 1   MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSF 60
           M+    + +   +A + L+N EQYE  Y+QS+ DPDTFWGE GK L+WI PY KVKNT++
Sbjct: 1   MTGKQVYPVSPEVAKQALLNREQYEEMYRQSVEDPDTFWGEHGKRLEWIKPYTKVKNTTY 60

Query: 61  APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRF 120
              N+SIKW+EDG LN +ANCLDRHL++ GD+TAII+EGDD + S++++YRELH +  +F
Sbjct: 61  DYNNLSIKWFEDGQLNASANCLDRHLEKRGDQTAIIFEGDDPADSRNVTYRELHEETSKF 120

Query: 121 ANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS 180
           AN L  LG+KKGDVV IYMPM+ E AVAMLACARIGA+HSV+FGGFSPEA+  RI++  S
Sbjct: 121 ANVLKGLGVKKGDVVTIYMPMIVETAVAMLACARIGAIHSVVFGGFSPEALGARIVNGKS 180

Query: 181 RLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTG-SDIDWQEGRDLWWRD 239
           R V+TADEGVR GR IPLKKNVD ALKN +  +VE V+V+ RTG S++ W E RD  + D
Sbjct: 181 RFVVTADEGVRGGRKIPLKKNVDAALKNEDAANVEKVVVVTRTGNSEVPWNEARDERYED 240

Query: 240 LIEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGD 299
           L++ AS + QPE MNAEDPLF+LYTSGSTG PKGVLHTTGGY+VYA+ T +YVFDYH GD
Sbjct: 241 LMKSASADCQPEPMNAEDPLFMLYTSGSTGAPKGVLHTTGGYMVYASMTHEYVFDYHEGD 300

Query: 300 IYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPT 359
           +YWCTAD GWVTGHSY+LYGPLA GA T++FEGVPN+P  +RM QVVDKH+VNILYTAPT
Sbjct: 301 VYWCTADFGWVTGHSYILYGPLANGAITVLFEGVPNYPDSSRMGQVVDKHKVNILYTAPT 360

Query: 360 AIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETG 419
           AIRALMAEG+  + GT R SL++LGSVGEPINPEAWEWY + IG  KCP+VDTWWQTETG
Sbjct: 361 AIRALMAEGESCMNGTTRESLKLLGSVGEPINPEAWEWYHRVIGNSKCPIVDTWWQTETG 420

Query: 420 GFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFG 479
           G +I+PLPGAI+LK GSAT PFFGVQPALVDN+G+  EG TEGNLVI DSWPGQ RT++G
Sbjct: 421 GILISPLPGAIDLKPGSATVPFFGVQPALVDNDGNILEGKTEGNLVILDSWPGQMRTIYG 480

Query: 480 DHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAH 539
           DHERF QTYFST+K MYF+GDGARRDEDGYYWITGRVDDVLNVSGHRLGTAE+ESALV+H
Sbjct: 481 DHERFAQTYFSTYKGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEVESALVSH 540

Query: 540 PKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWT 599
            K+AEAAVVG PH IKGQ IY YVTL HG+EPS EL  E+  WVRKEIGP+A+PDV+ W 
Sbjct: 541 EKVAEAAVVGYPHDIKGQGIYVYVTLVHGQEPSDELKKELVQWVRKEIGPIASPDVIQWA 600

Query: 600 DSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLL 642
             LPKTRSGKIMRRILRKIAA +   LGDTSTLADPGVV+ L+
Sbjct: 601 PGLPKTRSGKIMRRILRKIAANEHDQLGDTSTLADPGVVDDLI 643


Lambda     K      H
   0.317    0.135    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1485
Number of extensions: 64
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 652
Length of database: 649
Length adjustment: 38
Effective length of query: 614
Effective length of database: 611
Effective search space:   375154
Effective search space used:   375154
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

Align candidate GFF832 HP15_811 (acetyl-CoA synthetase)
to HMM TIGR02188 (acs: acetate--CoA ligase (EC 6.2.1.1))

Software error:

../bin/blast/fastacmd -i /tmp/list.17528.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.17528.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.