Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate GFF4122 HP15_4062 spermidine/putrescine ABC transporter, ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__Marino:GFF4122 Length = 373 Score = 238 bits (608), Expect = 1e-67 Identities = 125/287 (43%), Positives = 184/287 (64%), Gaps = 11/287 (3%) Query: 4 VTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEIG 63 ++L L K++G V+ G+DLE+ D EFI L+GPSGCGK+T LR++AG E G I + Sbjct: 6 LSLSNLSKQFGGKTVLDGLDLEIYDGEFITLLGPSGCGKTTLLRLMAGFEHPDEGTITLA 65 Query: 64 GRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAILDL 123 G + P R ++ VFQ YAL+PHM+V +N+ + LK+ RP +EI+ RV EA A++ L Sbjct: 66 GENLTHTAPENRPLNTVFQHYALFPHMSVFDNVAYGLKMEKRPKDEIRQRVDEALAMVQL 125 Query: 124 AHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLHARM 183 R+P QLSGGQ+QRVA+ RA+V++P + L DEPLS LD KLR ++ E+K+L + Sbjct: 126 QDFARRKPHQLSGGQQQRVAIARAVVKRPRLLLLDEPLSALDYKLRRTMQVELKRLQREL 185 Query: 184 QATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSP---PMN 240 T ++VTHDQ EA+++SDR+V+++DG ++Q+GTP +V+ RPA F A F+G P Sbjct: 186 GITFVFVTHDQEEALSMSDRVVVLKDGLVQQLGTPREVYERPANLFTARFVGETNFFPGT 245 Query: 241 MEEAVLTDGKL---AFASGATLPLPPRFRSLVREGQKVTFGLRPDDV 284 +E + DG + F TL P V+ Q + LRP+D+ Sbjct: 246 VES--VQDGSIKVDVFGLKRTLRRPD---FPVQAEQSLHVLLRPEDI 287 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 373 Length adjustment: 30 Effective length of query: 335 Effective length of database: 343 Effective search space: 114905 Effective search space used: 114905 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory