Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate GFF3902 HP15_3842 iron(III) ABC transporter, ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__Marino:GFF3902 Length = 371 Score = 207 bits (526), Expect = 5e-58 Identities = 116/264 (43%), Positives = 162/264 (61%), Gaps = 6/264 (2%) Query: 23 NVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDR 82 ++N+++E GE +LGPSG GKTT +RI AGL +P+ G+++ LV++ G + VPPE R Sbjct: 40 DINLHLEAGEVVCLLGPSGCGKTTLLRIAAGLQMPTRGKVFLGSSLVSAPGGVQVPPEKR 99 Query: 83 KIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELS 142 +G+ FQ AL+P+LT EN+ F +++M K++ R R E+ L + N +P LS Sbjct: 100 NVGLAFQESALFPHLTVLENVCFGISSMP--KKQQRTRALELLGRLGMADAANVYPHTLS 157 Query: 143 GGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPA 202 GGQQQRVALARAL P ++LLDEPFS+LDAR+RD R V L L+V+HDP Sbjct: 158 GGQQQRVALARALAPSPRVMLLDEPFSSLDARLRDQIRDDTLHVLKELNTATLLVTHDPE 217 Query: 203 DIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVV---IG 259 + +ADR+ ++ G++VQ G P DLY NP V + G++NE G V N GVV +G Sbjct: 218 EAMFMADRIALMRDGEIVQTGTPTDLYCNPAEPFVVNFFGQVNEHRGVVHN-GVVTTPLG 276 Query: 260 SLRFPVSVSSDRAIIGIRPEDVKL 283 L I IRPE VK+ Sbjct: 277 HLEAKGFEDGSSVRILIRPEAVKV 300 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 371 Length adjustment: 29 Effective length of query: 324 Effective length of database: 342 Effective search space: 110808 Effective search space used: 110808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory